Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Immunohistochemistry (IHC) (Rabbit Anti-NR2F2 antibodyParaffin Embedded Tissue: Human Lungcell Cellular Data: alveolar cellAntibody Concentration: 4.0-8.0 ug/mlMagnification: 400X)

Rabbit NR2F2 Polyclonal Antibody | anti-NR2F2 antibody

NR2F2 antibody - N-terminal region

Gene Names
NR2F2; ARP1; ARP-1; CHTD4; NF-E3; SVP40; COUPTF2; COUPTFB; TFCOUP2; COUPTFII
Reactivity
Cow, Dog, Human, Mouse, Pig, Rabbit, Rat, Sheep, Zebrafish
Applications
Immunohistochemistry, Western Blot
Purity
Affinity Purified
Synonyms
NR2F2; Polyclonal Antibody; NR2F2 antibody - N-terminal region; anti-NR2F2 antibody
Ordering
For Research Use Only!
Host
Rabbit
Reactivity
Cow, Dog, Human, Mouse, Pig, Rabbit, Rat, Sheep, Zebrafish
Clonality
Polyclonal
Purity/Purification
Affinity Purified
Form/Format
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence
Synthetic peptide located within the following region: KVGMRREAVQRGRMPPTQPTHGQFALTNGDPLNCHSYLSGYISLLLRAEP
Sequence Length
414
Applicable Applications for anti-NR2F2 antibody
Immunohistochemistry (IHC), Western Blot (WB)
Homology
Cow: 92%; Dog: 100%; Human: 100%; Mouse: 100%; Pig: 100%; Rabbit: 100%; Rat: 100%; Sheep: 92%; Zebrafish: 92%
Immunogen
The immunogen is a synthetic peptide directed towards the N terminal region of human NR2F2
Preparation and Storage
For short term use, store at 2-8 degree C up to 1 week. For long term storage, store at -20 degree C in small aliquots to prevent freeze-thaw cycles.

Immunohistochemistry (IHC)

(Rabbit Anti-NR2F2 antibodyParaffin Embedded Tissue: Human Lungcell Cellular Data: alveolar cellAntibody Concentration: 4.0-8.0 ug/mlMagnification: 400X)

Immunohistochemistry (IHC) (Rabbit Anti-NR2F2 antibodyParaffin Embedded Tissue: Human Lungcell Cellular Data: alveolar cellAntibody Concentration: 4.0-8.0 ug/mlMagnification: 400X)

Western Blot (WB)

(Host: RabbitTarget Name: COT2Sample Type: 293T Whole Cell lysatesAntibody Dilution: 1ug/ml)

Western Blot (WB) (Host: RabbitTarget Name: COT2Sample Type: 293T Whole Cell lysatesAntibody Dilution: 1ug/ml)

Western Blot (WB)

(Host: RabbitTarget Name: NR2F2Sample Type: MCF7 Whole Cell lysatesAntibody Dilution: 1.0ug/ml)

Western Blot (WB) (Host: RabbitTarget Name: NR2F2Sample Type: MCF7 Whole Cell lysatesAntibody Dilution: 1.0ug/ml)

Western Blot (WB)

(Host: RabbitTarget Name: NR2F2Sample Type: MCF7 Whole Cell lysatesAntibody Dilution: 1.0ug/ml)

Western Blot (WB) (Host: RabbitTarget Name: NR2F2Sample Type: MCF7 Whole Cell lysatesAntibody Dilution: 1.0ug/ml)
Related Product Information for anti-NR2F2 antibody
This is a rabbit polyclonal antibody against NR2F2. It was validated on Western Blot and immunohistochemistry

Target Description: NR2F2, an orphan member of the nuclear hormone receptor superfamily, acts as a transcriptional repressor by antagonizing the functions of other nuclear hormone receptors and by actively silencing transcription. However, in certain contexts, NR2F2 stimulates transcription directly. NR2F2, MyoD and p300 interact in a competitive manner, and that increasing amounts of NR2F2 have the ability to reduce the interaction between myoD and p300 invitro. NR2F2 post-transcriptionally regulates myoD activity/function, and that crosstalk between orphan nuclear receptors and the myogenic bHLH proteins has functional consequences for differentiation.

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
45kDa
NCBI Official Full Name
COUP transcription factor 2 isoform a
NCBI Official Synonym Full Names
nuclear receptor subfamily 2 group F member 2
NCBI Official Symbol
NR2F2
NCBI Official Synonym Symbols
ARP1; ARP-1; CHTD4; NF-E3; SVP40; COUPTF2; COUPTFB; TFCOUP2; COUPTFII
NCBI Protein Information
COUP transcription factor 2
UniProt Protein Name
COUP transcription factor 2
Protein Family
UniProt Gene Name
NR2F2
UniProt Synonym Gene Names
ARP1; TFCOUP2; COUP-TF2; ARP-1; COUP-TF II
UniProt Entry Name
COT2_HUMAN

NCBI Description

This gene encodes a member of the steroid thyroid hormone superfamily of nuclear receptors. The encoded protein is a ligand inducible transcription factor that is involved in the regulation of many different genes. Alternate splicing results in multiple transcript variants. [provided by RefSeq, Mar 2010]

Uniprot Description

NR2F2: Ligand-activated transcription factor. Activated by high concentrations of 9-cis-retinoic acid and all-trans-retinoic acid, but not by dexamethasone, cortisol or progesterone (in vitro). Regulation of the apolipoprotein A-I gene transcription. Binds to DNA site A. Interacts with SQSTM1. Binds DNA as a dimer; homodimer or heterodimer with NR2F6. Interacts with NCOA1, NCOA2, NCOA3 and PPARGC1A. Interacts with ZFPM2. Ubiquitous. Belongs to the nuclear hormone receptor family. NR2 subfamily. 3 isoforms of the human protein are produced by alternative splicing.

Protein type: DNA-binding; Nuclear receptor; Motility/polarity/chemotaxis

Chromosomal Location of Human Ortholog: 15q26

Cellular Component: nucleus

Molecular Function: ligand-dependent nuclear receptor activity; protein binding; protein homodimerization activity; retinoic acid binding; zinc ion binding; sequence-specific DNA binding; steroid hormone receptor activity; transcription corepressor activity; transcription factor activity

Biological Process: limb development; skeletal muscle development; intracellular receptor-mediated signaling pathway; transcription, DNA-dependent; positive regulation of transcription, DNA-dependent; neuron migration; negative regulation of cyclin-dependent protein kinase activity; negative regulation of transcription from RNA polymerase II promoter; signal transduction; response to estradiol stimulus; anterior/posterior pattern formation; regulation of transcription from RNA polymerase II promoter; fertilization; forebrain development; negative regulation of endothelial cell proliferation; blood vessel morphogenesis; steroid hormone mediated signaling; lipid metabolic process; negative regulation of transcription, DNA-dependent; radial pattern formation; maternal placenta development

Disease: Congenital Heart Defects, Multiple Types, 4

Research Articles on NR2F2

Similar Products

Product Notes

The NR2F2 nr2f2 (Catalog #AAA3224612) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The NR2F2 antibody - N-terminal region reacts with Cow, Dog, Human, Mouse, Pig, Rabbit, Rat, Sheep, Zebrafish and may cross-react with other species as described in the data sheet. AAA Biotech's NR2F2 can be used in a range of immunoassay formats including, but not limited to, Immunohistochemistry (IHC), Western Blot (WB). Researchers should empirically determine the suitability of the NR2F2 nr2f2 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: Synthetic peptide located within the following region: KVGMRREAVQ RGRMPPTQPT HGQFALTNGD PLNCHSYLSG YISLLLRAEP. It is sometimes possible for the material contained within the vial of "NR2F2, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.