Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (Host: RabbitTarget Name: NPYSample Type: Esophagus Tumor lysatesAntibody Dilution: 1.0ug/ml)

Rabbit NPY Polyclonal Antibody | anti-NPY antibody

NPY Antibody - middle region

Gene Names
NPY; PYY4
Reactivity
Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat, Sheep, Zebrafish
Applications
Western Blot
Purity
Affinity Purified
Synonyms
NPY; Polyclonal Antibody; NPY Antibody - middle region; anti-NPY antibody
Ordering
For Research Use Only!
Host
Rabbit
Reactivity
Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat, Sheep, Zebrafish
Clonality
Polyclonal
Purity/Purification
Affinity Purified
Form/Format
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence
Synthetic peptide located within the following region: CLGALAEAYPSKPDNPGEDAPAEDMARYYSALRHYINLITRQRYGKRSSP
Sequence Length
97
Applicable Applications for anti-NPY antibody
Western Blot (WB)
Homology
Cow: 100%; Dog: 100%; Guinea Pig: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Rabbit: 100%; Rat: 100%; Sheep: 93%; Zebrafish: 93%
Immunogen
The immunogen is a synthetic peptide directed towards the middle region of Human NPY
Preparation and Storage
For short term use, store at 2-8 degree C up to 1 week. For long term storage, store at -20 degree C in small aliquots to prevent freeze-thaw cycles.

Western Blot (WB)

(Host: RabbitTarget Name: NPYSample Type: Esophagus Tumor lysatesAntibody Dilution: 1.0ug/ml)

Western Blot (WB) (Host: RabbitTarget Name: NPYSample Type: Esophagus Tumor lysatesAntibody Dilution: 1.0ug/ml)
Related Product Information for anti-NPY antibody
This is a rabbit polyclonal antibody against NPY. It was validated on Western Blot

Target Description: NPY is implicated in the control of feeding and in secretion of gonadotrophin-release hormone.
Product Categories/Family for anti-NPY antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
10kDa
NCBI Official Full Name
pro-neuropeptide Y preproprotein
NCBI Official Synonym Full Names
neuropeptide Y
NCBI Official Symbol
NPY
NCBI Official Synonym Symbols
PYY4
NCBI Protein Information
pro-neuropeptide Y
UniProt Protein Name
Pro-neuropeptide Y
Protein Family
UniProt Gene Name
NPY
UniProt Synonym Gene Names
NPY; CPON
UniProt Entry Name
NPY_HUMAN

NCBI Description

This gene encodes a neuropeptide that is widely expressed in the central nervous system and influences many physiological processes, including cortical excitability, stress response, food intake, circadian rhythms, and cardiovascular function. The neuropeptide functions through G protein-coupled receptors to inhibit adenylyl cyclase, activate mitogen-activated protein kinase (MAPK), regulate intracellular calcium levels, and activate potassium channels. A polymorphism in this gene resulting in a change of leucine 7 to proline in the signal peptide is associated with elevated cholesterol levels, higher alcohol consumption, and may be a risk factor for various metabolic and cardiovascular diseases. The protein also exhibits antimicrobial activity against bacteria and fungi. [provided by RefSeq, Oct 2014]

Uniprot Description

NPY: NPY is implicated in the control of feeding and in secretion of gonadotrophin-release hormone. Belongs to the NPY family.

Protein type: Hormone; Secreted; Secreted, signal peptide

Chromosomal Location of Human Ortholog: 7p15.1

Cellular Component: Golgi apparatus; extracellular space; cell; extracellular region

Molecular Function: G-protein coupled receptor activity; neuropeptide hormone activity; neuropeptide Y receptor binding; calcium channel regulator activity; receptor binding

Biological Process: blood circulation; behavior; adult feeding behavior; synaptic transmission; cell proliferation; G-protein signaling, coupled to cyclic nucleotide second messenger; neuropeptide signaling pathway; regulation of blood pressure; calcium ion transport; positive regulation of appetite; regulation of appetite; digestion; feeding behavior; cerebral cortex development; cell motility; neurite development; central nervous system neuron development

Research Articles on NPY

Similar Products

Product Notes

The NPY npy (Catalog #AAA3206058) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The NPY Antibody - middle region reacts with Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat, Sheep, Zebrafish and may cross-react with other species as described in the data sheet. AAA Biotech's NPY can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). Researchers should empirically determine the suitability of the NPY npy for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: Synthetic peptide located within the following region: CLGALAEAYP SKPDNPGEDA PAEDMARYYS ALRHYINLIT RQRYGKRSSP. It is sometimes possible for the material contained within the vial of "NPY, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.