Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (Anti- TSG101 antibody, Western blottingAll lanes: Anti TSG101 at 0.5ug/ml)

anti-Human, Rat TSG101 Polyclonal Antibody | anti-TSG101 antibody

Anti-TSG101 Antibody

Gene Names
TSG101; TSG10; VPS23
Reactivity
Human, Rat
Applications
Western Blot
Purity
Immunogen Affinity Purified
Synonyms
TSG101; Polyclonal Antibody; Anti-TSG101 Antibody; Tumor susceptibility gene 101 protein; ESCRT I complex subunit TSG101; ESCRT-I complex subunit TSG101; TS101_HUMAN; TSG 10; TSG 101; ; TSG10; Tsg101; Tumor susceptibility gene 10; Tumor susceptibility gene 101; Tumor susceptibility protein; Tumor susceptibility protein isoform 3; VPS 23; VPS23; tumor susceptibility 101; anti-TSG101 antibody
Ordering
For Research Use Only!
Reactivity
Human, Rat
Clonality
Polyclonal
Purity/Purification
Immunogen Affinity Purified
Form/Format
Lyophilized. Each vial contains 5mg BSA, 0.9mg NaCl, 0.2mg Na2HPO4, 0.05mg NaN3.
Sequence Length
390
Applicable Applications for anti-TSG101 antibody
Western Blot (WB)
Application Notes
Western Blot Concentration: 0.1-0.5ug/ml
Immunogen
A synthetic peptide corresponding to a sequence at the C-terminus of human TSG101 (361-390aa KHVRLLSRKQFQLRALMQKARKTAGLSDLY), identical to the related mouse and rat sequences.
Ig Type
Rabbit IgG
Reconstitution
Add 0.2ml of distilled water will yield a concentration of 500ug/ml.
Preparation and Storage
At -20 degree C for one year. After reconstitution, at 4 degree C for one month. It can also be aliquoted and stored frozen at -20 degree C for a longer time. Avoid repeated freezing and thawing.

Western Blot (WB)

(Anti- TSG101 antibody, Western blottingAll lanes: Anti TSG101 at 0.5ug/ml)

Western Blot (WB) (Anti- TSG101 antibody, Western blottingAll lanes: Anti TSG101 at 0.5ug/ml)
Related Product Information for anti-TSG101 antibody
Description: Rabbit IgG polyclonal antibody for Tumor susceptibility gene 101 protein(TSG101) detection. Tested with WB in Human;Rat.

Background: TSG101, known as Tumor susceptibility gene 101, is mapped to 11p15. The protein encoded by this gene belongs to a group of apparently inactive homologs of ubiquitin-conjugating enzymes. The gene product contains a coiled-coil domain that interacts with stathmin, a cytosolic phosphoprotein implicated in tumorigenesis. And the protein may play a role in cell growth and differentiation and act as a negative growth regulator. In vitro steady-state expression of this tumor susceptibility gene appears to be important for maintenance of genomic stability and cell cycle regulation. Mutations and alternative splicing in this gene occur in high frequency in breast cancer and suggest that defects occur during breast cancer tumorigenesis and/or progression.
References
1. "Entrez Gene: TSG101 tumor susceptibility gene 101". 2. Lu Q, Hope LW, Brasch M, Reinhard C, Cohen SN (June 2003). "TSG101 interaction with HRS mediates endosomal trafficking and receptor down-regulation".Proc. Natl. Acad. Sci. U.S.A. 100 (13): 7626-31. 3. Sun Z, Pan J, Hope WX, Cohen SN, Balk SP (August 1999). "Tumor susceptibility gene 101 protein represses androgen receptor transactivation and interacts with p300". Cancer 86 (4): 689-96.

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
31,732 Da
NCBI Official Full Name
tumor susceptibility gene 101 protein
NCBI Official Synonym Full Names
tumor susceptibility 101
NCBI Official Symbol
TSG101
NCBI Official Synonym Symbols
TSG10; VPS23
NCBI Protein Information
tumor susceptibility gene 101 protein
UniProt Protein Name
Tumor susceptibility gene 101 protein
UniProt Gene Name
TSG101
UniProt Entry Name
TS101_HUMAN

NCBI Description

The protein encoded by this gene belongs to a group of apparently inactive homologs of ubiquitin-conjugating enzymes. The gene product contains a coiled-coil domain that interacts with stathmin, a cytosolic phosphoprotein implicated in tumorigenesis. The protein may play a role in cell growth and differentiation and act as a negative growth regulator. In vitro steady-state expression of this tumor susceptibility gene appears to be important for maintenance of genomic stability and cell cycle regulation. Mutations and alternative splicing in this gene occur in high frequency in breast cancer and suggest that defects occur during breast cancer tumorigenesis and/or progression. [provided by RefSeq, Jul 2008]

Uniprot Description

TSG101: Component of the ESCRT-I complex, a regulator of vesicular trafficking process. Binds to ubiquitinated cargo proteins and is required for the sorting of endocytic ubiquitinated cargos into multivesicular bodies (MVBs). Mediates the association between the ESCRT-0 and ESCRT-I complex. Required for completion of cytokinesis; the function requires CEP55. May be involved in cell growth and differentiation. Acts as a negative growth regulator. Involved in the budding of many viruses through an interaction with viral proteins that contain a late-budding motif P-[ST]-A-P. This interaction is essential for viral particle budding of numerous retroviruses. Belongs to the ubiquitin-conjugating enzyme family. UEV subfamily. 2 isoforms of the human protein are produced by alternative splicing.

Protein type: Nuclear receptor co-regulator; Cell cycle regulation

Chromosomal Location of Human Ortholog: 11p15

Cellular Component: cytoplasm; early endosome; endosome; endosome membrane; late endosome; late endosome membrane; multivesicular body; nucleolus; plasma membrane

Molecular Function: calcium-dependent protein binding; DNA binding; ligand-dependent nuclear receptor transcription coactivator activity; protein binding; protein homodimerization activity; transcription corepressor activity; ubiquitin binding; ubiquitin protein ligase binding; virion binding

Biological Process: autophagy; cell cycle arrest; cell division; endosome to lysosome transport; endosome transport; keratinocyte differentiation; negative regulation of cell proliferation; negative regulation of transcription, DNA-dependent; non-lytic virus budding; positive regulation of viral reproduction; protein monoubiquitination; protein transport; regulation of cell growth; regulation of MAP kinase activity; ubiquitin-dependent protein catabolic process via the multivesicular body pathway; viral infectious cycle

Disease: Breast Cancer

Research Articles on TSG101

Similar Products

Product Notes

The TSG101 tsg101 (Catalog #AAA178116) is an Antibody and is intended for research purposes only. The product is available for immediate purchase. The Anti-TSG101 Antibody reacts with Human, Rat and may cross-react with other species as described in the data sheet. AAA Biotech's TSG101 can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). Western Blot Concentration: 0.1-0.5ug/ml. Researchers should empirically determine the suitability of the TSG101 tsg101 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. It is sometimes possible for the material contained within the vial of "TSG101, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.