Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (Host: RabbitTarget Name: NPAS3Sample Type: THP-1 Whole Cell lysatesAntibody Dilution: 1.0ug/ml)

Rabbit NPAS3 Polyclonal Antibody | anti-NPAS3 antibody

NPAS3 Antibody - middle region

Gene Names
NPAS3; MOP6; PASD6; bHLHe12
Reactivity
Cow, Dog, Goat, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat, Zebrafish
Applications
Western Blot
Purity
Affinity Purified
Synonyms
NPAS3; Polyclonal Antibody; NPAS3 Antibody - middle region; anti-NPAS3 antibody
Ordering
For Research Use Only!
Host
Rabbit
Reactivity
Cow, Dog, Goat, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat, Zebrafish
Clonality
Polyclonal
Purity/Purification
Affinity Purified
Form/Format
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence
Synthetic peptide located within the following region: CESTYQNLQALRKEKSRDAARSRRGKENFEFYELAKLLPLPAAITSQLDK
Sequence Length
257
Applicable Applications for anti-NPAS3 antibody
Western Blot (WB)
Homology
Cow: 100%; Dog: 100%; Goat: 100%; Guinea Pig: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Rabbit: 100%; Rat: 100%; Zebrafish: 100%
Immunogen
The immunogen is a synthetic peptide directed towards the middle region of Human NPAS3
Preparation and Storage
For short term use, store at 2-8 degree C up to 1 week. For long term storage, store at -20 degree C in small aliquots to prevent freeze-thaw cycles.

Western Blot (WB)

(Host: RabbitTarget Name: NPAS3Sample Type: THP-1 Whole Cell lysatesAntibody Dilution: 1.0ug/ml)

Western Blot (WB) (Host: RabbitTarget Name: NPAS3Sample Type: THP-1 Whole Cell lysatesAntibody Dilution: 1.0ug/ml)
Related Product Information for anti-NPAS3 antibody
This is a rabbit polyclonal antibody against NPAS3. It was validated on Western Blot

Target Description: This gene encodes a member of the basic helix-loop-helix and PAS domain-containing family of transcription factors. The encoded protein is localized to the nucleus and may regulate genes involved in neurogenesis. Chromosomal abnormalities that affect the coding potential of this gene are associated with schizophrenia and mental retardation. Alternate splicing results in multiple transcript variants.
Product Categories/Family for anti-NPAS3 antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
28kDa
NCBI Official Full Name
neuronal PAS domain-containing protein 3 isoform 1
NCBI Official Synonym Full Names
neuronal PAS domain protein 3
NCBI Official Symbol
NPAS3
NCBI Official Synonym Symbols
MOP6; PASD6; bHLHe12
NCBI Protein Information
neuronal PAS domain-containing protein 3
UniProt Protein Name
Neuronal PAS domain-containing protein 3
UniProt Gene Name
NPAS3
UniProt Synonym Gene Names
BHLHE12; MOP6; PASD6; Neuronal PAS3; bHLHe12
UniProt Entry Name
NPAS3_HUMAN

NCBI Description

This gene encodes a member of the basic helix-loop-helix and PAS domain-containing family of transcription factors. The encoded protein is localized to the nucleus and may regulate genes involved in neurogenesis. Chromosomal abnormalities that affect the coding potential of this gene are associated with schizophrenia and cognitive disability. Alternate splicing results in multiple transcript variants. [provided by RefSeq, Sep 2009]

Uniprot Description

NPAS3: May play a broad role in neurogenesis. May control regulatory pathways relevant to schizophrenia and to psychotic illness. A chromosomal aberration involving NPAS3 is found in a family with schizophrenia. Translocation t(9;14)(q34;q13). 6 isoforms of the human protein are produced by alternative splicing.

Protein type: Motility/polarity/chemotaxis; Transcription factor

Chromosomal Location of Human Ortholog: 14q13.1

Cellular Component: nucleoplasm; cytoplasm

Molecular Function: protein dimerization activity; signal transducer activity; DNA binding

Biological Process: startle response; transcription, DNA-dependent; maternal behavior; positive regulation of transcription, DNA-dependent; locomotory behavior; signal transduction

Research Articles on NPAS3

Similar Products

Product Notes

The NPAS3 npas3 (Catalog #AAA3204927) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The NPAS3 Antibody - middle region reacts with Cow, Dog, Goat, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat, Zebrafish and may cross-react with other species as described in the data sheet. AAA Biotech's NPAS3 can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). Researchers should empirically determine the suitability of the NPAS3 npas3 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: Synthetic peptide located within the following region: CESTYQNLQA LRKEKSRDAA RSRRGKENFE FYELAKLLPL PAAITSQLDK. It is sometimes possible for the material contained within the vial of "NPAS3, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.