Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (Host: RabbitTarget Name: NOX5Sample Type: Jurkat Whole Cell lysatesAntibody Dilution: 1.0ug/ml)

Rabbit NOX5 Polyclonal Antibody | anti-NOX5 antibody

NOX5 Antibody - C-terminal region

Reactivity
Cow, Human, Pig, Rabbit
Applications
Western Blot
Purity
Affinity Purified
Synonyms
NOX5; Polyclonal Antibody; NOX5 Antibody - C-terminal region; anti-NOX5 antibody
Ordering
For Research Use Only!
Host
Rabbit
Reactivity
Cow, Human, Pig, Rabbit
Clonality
Polyclonal
Purity/Purification
Affinity Purified
Form/Format
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence
Synthetic peptide located within the following region: DQAEEAQYGRFLELHMYMTSALGKNDMKAIGLQMALDLLANKEKKDSITG
Sequence Length
565
Applicable Applications for anti-NOX5 antibody
Western Blot (WB)
Homology
Cow: 86%; Human: 100%; Pig: 79%; Rabbit: 100%
Immunogen
The immunogen is a synthetic peptide directed towards the C-terminal region of Human NOX5
Preparation and Storage
For short term use, store at 2-8 degree C up to 1 week. For long term storage, store at -20 degree C in small aliquots to prevent freeze-thaw cycles.

Western Blot (WB)

(Host: RabbitTarget Name: NOX5Sample Type: Jurkat Whole Cell lysatesAntibody Dilution: 1.0ug/ml)

Western Blot (WB) (Host: RabbitTarget Name: NOX5Sample Type: Jurkat Whole Cell lysatesAntibody Dilution: 1.0ug/ml)
Related Product Information for anti-NOX5 antibody
This is a rabbit polyclonal antibody against NOX5. It was validated on Western Blot

Target Description: This gene is predominantly expressed in the testis and lymphocyte-rich areas of spleen and lymph nodes. It encodes a calcium-dependen NADPH oxidase that generates superoxide, and functions as a calcium-dependent proton channel that may regulate redox-dependent processes in lymphocytes and spermatozoa. Alternatively spliced transcript variants encoding different isoforms have been described for this gene.
Product Categories/Family for anti-NOX5 antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
62kDa
NCBI Official Full Name
NADPH oxidase 5 isoform 2
NCBI Official Synonym Full Names
NADPH oxidase 5
NCBI Official Symbol
NOX5
NCBI Protein Information
NADPH oxidase 5
UniProt Protein Name
NADPH oxidase 5
Protein Family
UniProt Gene Name
NOX5
UniProt Entry Name
NOX5_HUMAN

NCBI Description

This gene is predominantly expressed in the testis and lymphocyte-rich areas of spleen and lymph nodes. It encodes a calcium-dependen NADPH oxidase that generates superoxide, and functions as a calcium-dependent proton channel that may regulate redox-dependent processes in lymphocytes and spermatozoa. Alternatively spliced transcript variants encoding different isoforms have been described for this gene. [provided by RefSeq, Oct 2011]

Uniprot Description

NOX5: Calcium-dependent NADPH oxidase that generates superoxide. Also functions as a calcium-dependent proton channel and may regulate redox-dependent processes in lymphocytes and spermatozoa. May play a role in cell growth and apoptosis. Isoform v2 and isoform v5 are involved in endothelial generation of reactive oxygen species (ROS), proliferation and angiogenesis and contribute to endothelial response to thrombin. 6 isoforms of the human protein are produced by alternative splicing.

Protein type: Membrane protein, integral; EC 1.6.3.-; Membrane protein, multi-pass; Oxidoreductase

Chromosomal Location of Human Ortholog: 15q23

Cellular Component: endoplasmic reticulum; integral to membrane

Molecular Function: protein binding; FAD binding; superoxide-generating NADPH oxidase activity; heme binding; hydrogen ion channel activity; calcium ion binding; NADP binding

Biological Process: cell proliferation; proton transport; regulation of fusion of sperm to egg plasma membrane; apoptosis; endothelial cell proliferation; regulation of proton transport; cytokinesis; angiogenesis; superoxide release; cytokine secretion

Research Articles on NOX5

Similar Products

Product Notes

The NOX5 nox5 (Catalog #AAA3209653) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The NOX5 Antibody - C-terminal region reacts with Cow, Human, Pig, Rabbit and may cross-react with other species as described in the data sheet. AAA Biotech's NOX5 can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). Researchers should empirically determine the suitability of the NOX5 nox5 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: Synthetic peptide located within the following region: DQAEEAQYGR FLELHMYMTS ALGKNDMKAI GLQMALDLLA NKEKKDSITG. It is sometimes possible for the material contained within the vial of "NOX5, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.