Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (Host: RabbitTarget Name: NOX1Sample Tissue: U937 Whole Cell lysatesAntibody Dilution: 1ug/ml)

Rabbit anti-Human NOX1 Polyclonal Antibody | anti-NOX1 antibody

NOX1 Antibody - C-terminal region

Gene Names
NOX1; MOX1; NOH1; NOH-1; GP91-2
Reactivity
Human
Applications
Western Blot
Purity
Affinity purified
Synonyms
NOX1; Polyclonal Antibody; NOX1 Antibody - C-terminal region; anti-NOX1 antibody
Ordering
For Research Use Only!
Host
Rabbit
Reactivity
Human
Clonality
Polyclonal
Purity/Purification
Affinity purified
Form/Format
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 23% sucrose.
Sequence
Synthetic peptide located within the following region: KVGFLNYRLFLTGWDSNIVGHAALNFDKATDIVTGLKQKTSFGRPMWDNE
Sequence Length
564
Applicable Applications for anti-NOX1 antibody
Western Blot (WB)
Immunogen
The immunogen is a synthetic peptide directed towards the C region of human NOX1
Preparation and Storage
For short term use, store at 2-8 degree C up to 1 week. For long term storage, store at -20 degree C in small aliquots to prevent freeze-thaw cycles.

Western Blot (WB)

(Host: RabbitTarget Name: NOX1Sample Tissue: U937 Whole Cell lysatesAntibody Dilution: 1ug/ml)

Western Blot (WB) (Host: RabbitTarget Name: NOX1Sample Tissue: U937 Whole Cell lysatesAntibody Dilution: 1ug/ml)
Related Product Information for anti-NOX1 antibody
This gene encodes a member of the NADPH oxidase family of enzymes responsible for the catalytic one-electron transfer of oxygen to generate superoxide or hydrogen peroxide. Alternatively spliced transcript variants encoding multiple isoforms have been observed for this gene.
Product Categories/Family for anti-NOX1 antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
62 kDa
NCBI Official Full Name
NADPH oxidase 1 isoform 3
NCBI Official Synonym Full Names
NADPH oxidase 1
NCBI Official Symbol
NOX1
NCBI Official Synonym Symbols
MOX1; NOH1; NOH-1; GP91-2
NCBI Protein Information
NADPH oxidase 1
UniProt Protein Name
NADPH oxidase 1
Protein Family
UniProt Gene Name
NOX1
UniProt Synonym Gene Names
MOX1; NOH1; NOX-1; MOX-1
UniProt Entry Name
NOX1_HUMAN

NCBI Description

This gene encodes a member of the NADPH oxidase family of enzymes responsible for the catalytic one-electron transfer of oxygen to generate superoxide or hydrogen peroxide. Alternatively spliced transcript variants encoding multiple isoforms have been observed for this gene. [provided by RefSeq, Nov 2012]

Uniprot Description

NOX1: NOH-1S is a voltage-gated proton channel that mediates the H(+) currents of resting phagocytes and other tissues. It participates in the regulation of cellular pH and is blocked by zinc. NOH-1L is a pyridine nucleotide-dependent oxidoreductase that generates superoxide and might conduct H(+) ions as part of its electron transport mechanism, whereas NOH-1S does not contain an electron transport chain. 3 isoforms of the human protein are produced by alternative splicing.

Protein type: Membrane protein, multi-pass; EC 1.-.-.-; Motility/polarity/chemotaxis; Channel, misc.; Membrane protein, integral; Oxidoreductase

Chromosomal Location of Human Ortholog: Xq22

Cellular Component: early endosome; integral to membrane; cell junction; NADPH oxidase complex

Molecular Function: protein binding; superoxide-generating NADPH oxidase activity; metal ion binding; Rac GTPase binding; NADP binding; voltage-gated proton channel activity

Biological Process: intracellular pH elevation; respiratory burst; cell migration; extracellular matrix organization and biogenesis; positive regulation of smooth muscle cell proliferation; superoxide metabolic process; positive regulation of JNK cascade; signal transduction; NADP metabolic process; regulation of systemic arterial blood pressure by renin-angiotensin; proton transport; regulation of blood pressure; positive regulation of cell proliferation; hydrogen peroxide metabolic process; angiogenesis; positive regulation of integrin biosynthetic process; inflammatory response; superoxide release

Research Articles on NOX1

Similar Products

Product Notes

The NOX1 nox1 (Catalog #AAA3220627) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The NOX1 Antibody - C-terminal region reacts with Human and may cross-react with other species as described in the data sheet. AAA Biotech's NOX1 can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). Researchers should empirically determine the suitability of the NOX1 nox1 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: Synthetic peptide located within the following region: KVGFLNYRLF LTGWDSNIVG HAALNFDKAT DIVTGLKQKT SFGRPMWDNE. It is sometimes possible for the material contained within the vial of "NOX1, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.