Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (WB Suggested Anti-NMUR2 Antibody Titration: 0.2-1 ug/mlELISA Titer: 1:312500Positive Control: HepG2 cell lysate)

Rabbit anti-Human NMUR2 Polyclonal Antibody | anti-NMUR2 antibody

NMUR2 antibody - N-terminal region

Gene Names
NMUR2; FM4; FM-4; TGR1; NMU2R; TGR-1; NMU-R2
Reactivity
Human
Applications
Western Blot
Purity
Affinity Purified
Synonyms
NMUR2; Polyclonal Antibody; NMUR2 antibody - N-terminal region; anti-NMUR2 antibody
Ordering
For Research Use Only!
Host
Rabbit
Reactivity
Human
Clonality
Polyclonal
Purity/Purification
Affinity Purified
Form/Format
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence
Synthetic peptide located within the following region: MSGMEKLQNASWIYQQKLEDPFQKHLNSTEEYLAFLCGPRRSHFFLPVSV
Sequence Length
415
Applicable Applications for anti-NMUR2 antibody
Western Blot (WB)
Homology
Human: 100%
Immunogen
The immunogen is a synthetic peptide directed towards the N terminal region of human NMUR2
Preparation and Storage
For short term use, store at 2-8 degree C up to 1 week. For long term storage, store at -20 degree C in small aliquots to prevent freeze-thaw cycles.

Western Blot (WB)

(WB Suggested Anti-NMUR2 Antibody Titration: 0.2-1 ug/mlELISA Titer: 1:312500Positive Control: HepG2 cell lysate)

Western Blot (WB) (WB Suggested Anti-NMUR2 Antibody Titration: 0.2-1 ug/mlELISA Titer: 1:312500Positive Control: HepG2 cell lysate)
Related Product Information for anti-NMUR2 antibody
This is a rabbit polyclonal antibody against NMUR2. It was validated on Western Blot using a cell lysate as a positive control.

Target Description: NMUR2 encodes for one of two G-protein-coupled receptors for the neuropeptide, neuromedin U. This peptide is found in highest levels in the gut and genitourinary system where it potently contracts smooth muscle but is also expressed in the spinal cord and discrete regions of the brain. NMUR2 is highly expressed in the central nervous system.
Product Categories/Family for anti-NMUR2 antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
46kDa
NCBI Official Full Name
neuromedin-U receptor 2
NCBI Official Synonym Full Names
neuromedin U receptor 2
NCBI Official Symbol
NMUR2
NCBI Official Synonym Symbols
FM4; FM-4; TGR1; NMU2R; TGR-1; NMU-R2
NCBI Protein Information
neuromedin-U receptor 2
UniProt Protein Name
Neuromedin-U receptor 2
Protein Family
UniProt Gene Name
NMUR2
UniProt Synonym Gene Names
NMU2R; TGR1; NMU-R2
UniProt Entry Name
NMUR2_HUMAN

NCBI Description

This gene encodes a protein from the G-protein coupled receptor 1 family. This protein is a receptor for neuromedin U, which is a neuropeptide that is widely distributed in the gut and central nervous system. This receptor plays an important role in the regulation of food intake and body weight. [provided by RefSeq, Jul 2008]

Uniprot Description

NMUR2: Receptor for the neuromedin-U and neuromedin-S neuropeptides. Belongs to the G-protein coupled receptor 1 family.

Protein type: Membrane protein, integral; GPCR, family 1; Receptor, GPCR; Membrane protein, multi-pass

Chromosomal Location of Human Ortholog: 5q33.1

Cellular Component: plasma membrane; integral to membrane

Molecular Function: G-protein coupled receptor activity; GTP binding; intracellular calcium activated chloride channel activity; neuromedin U receptor activity; neuromedin U binding

Biological Process: grooming behavior; regulation of smooth muscle contraction; inositol phosphate-mediated signaling; central nervous system development; calcium-mediated signaling; chloride transport; response to pain; arachidonic acid secretion; reduction of food intake in response to dietary excess; elevation of cytosolic calcium ion concentration; cell-cell signaling; neuropeptide signaling pathway; calcium ion transport; calcium-dependent phospholipase A2 activation; G-protein signaling, coupled to IP3 second messenger (phospholipase C activating); feeding behavior

Research Articles on NMUR2

Similar Products

Product Notes

The NMUR2 nmur2 (Catalog #AAA3202518) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The NMUR2 antibody - N-terminal region reacts with Human and may cross-react with other species as described in the data sheet. AAA Biotech's NMUR2 can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). Researchers should empirically determine the suitability of the NMUR2 nmur2 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: Synthetic peptide located within the following region: MSGMEKLQNA SWIYQQKLED PFQKHLNSTE EYLAFLCGPR RSHFFLPVSV. It is sometimes possible for the material contained within the vial of "NMUR2, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.