Rabbit anti-Human NME3 Polyclonal Antibody | anti-NME3 antibody

NME3 (Nucleoside Diphosphate Kinase C, NDPKC, NDPK-C, c371H6.2, DR-nm23, KIAA0516, Nucleoside Diphosphate Kinase 3, NDP Kinase 3, NDK 3, NDK3, NM23H3, nm23-H3) (HRP)

Cat. Num. AAA6387154

• Gene Names: NME3; NDPKC; NDPK-C; NM23H3; DR-nm23; NM23-H3; c371H6.2
• Reactivity: Human
• Applications: Western Blot
• Purity: Purified by Protein A Affinity Chromatography.
• Synonyms: NME3; Polyclonal Antibody; NME3 (Nucleoside Diphosphate Kinase C; NDPKC; NDPK-C; c371H6.2; DR-nm23; KIAA0516; Nucleoside Diphosphate Kinase 3; NDP Kinase 3; NDK 3; NDK3; NM23H3; nm23-H3) (HRP); anti-NME3 antibody

• Host: Rabbit
• Reactivity: Human
• Clonality: Polyclonal
• Isotype: IgG
• Specificity: Recognizes human NME3.
• Purity/Purification: Purified by Protein A Affinity Chromatography.
• Form/Format: Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with Horseradish Peroxidase (HRP).

• Applicable Applications for anti-NME3 antibody: Western Blot (WB)
• Application Notes: Applications are based on unconjugated antibody.
• Immunogen: Full length human NME3, aa1-169 (NP_002504.2).
• Immunogen Sequence: MICLVLTIFANLFPAACTGAHERTFLAVKPDGVQRRLVGEIVRRFERKGFKLVALKLVQASEELLREHYAELRERPFYGRLVKYMASGPVVAMVWQGLDVVRTSRALIGATNPADAPPGTIRGDFCIEVGKNLIHGSDSVESARREIALWFRADELLCWEDSAGHWLYE
• Conjugate: HRP
• Note: Preservative Free
• Preparation and Storage: Store product at 4 degree C if to be used immediately within two weeks. For long-term storage, aliquot to avoid repeated freezing and thawing and store at -20 degree C. Aliquots are stable at -20 degree C for 12 months after receipt. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. Note: Sodium azide is a potent inhibitor of peroxidase and should not be added to HRP conjugates. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.

Western Blot (WB)

(Western Blot analysis of NME3 expression in transfected 293T cell line by NME3 polyclonal antibody. Lane 1: NME3 transfected lysate (19kD). Lane 2: Non-transfected lysate.)

Related Product Information for anti-NME3 antibody

NME3 mRNA is preferentially expressed at early stages of myeloid differentiation of highly purified CD34(+) cells. Its constitutive expression in a myeloid precursor line, which is growth-factor dependent for both proliferation and differentiation, results in inhibition of granulocytic differentiation induced by granulocyte colony-stimulating factor and causes apoptotic cell death. These results appear consistent with a role for the NME3 gene in normal hematopoiesis and raise the possibility that its overexpression contributes to differentiation arrest, a feature of blastic transformation in chronic myelogenous leukemia.

Product Categories/Family for anti-NME3 antibody

Antibodies; Protein Kinases

NCBI and Uniprot Product Information

• NCBI GI #: 37693993
• NCBI GeneID: 4832
• NCBI Accession #: NP_002504.2
• NCBI GenBank Nucleotide #: NM_002513
• UniProt Accession #: Q13232; Q9BWH4
• Molecular Weight: 19,015 Da
• NCBI Official Full Name: nucleoside diphosphate kinase 3
• NCBI Official Synonym Full Names: NME/NM23 nucleoside diphosphate kinase 3
• NCBI Official Symbol: NME3
• NCBI Official Synonym Symbols: NDPKC; NDPK-C; NM23H3; DR-nm23; NM23-H3; c371H6.2
• NCBI Protein Information: nucleoside diphosphate kinase 3; NDK 3; NDP kinase 3; NDP kinase C; non-metastatic cells 3, protein expressed in; nucleoside diphosphate kinase C
• UniProt Protein Name: Nucleoside diphosphate kinase 3
• Protein Family: Nucleoside diphosphate kinase
• UniProt Gene Name: NME3
• UniProt Synonym Gene Names: NDK 3; NDP kinase 3; NDPKC
• UniProt Entry Name: NDK3_HUMAN

Uniprot Description

NME3: Major role in the synthesis of nucleoside triphosphates other than ATP. The ATP gamma phosphate is transferred to the NDP beta phosphate via a ping-pong mechanism, using a phosphorylated active-site intermediate. Probably has a role in normal hematopoiesis by inhibition of granulocyte differentiation and induction of apoptosis. Belongs to the NDK family.

Protein type: Kinase, other; Kinase, nucleoside diphosphate; Nucleotide Metabolism - pyrimidine; EC 2.7.4.6; Apoptosis; Motility/polarity/chemotaxis; Nucleotide Metabolism - purine; Other group; NDK family

Chromosomal Location of Human Ortholog: 16q13.3

Cellular Component: mitochondrion; cytosol

Molecular Function: metal ion binding; nucleoside diphosphate kinase activity; ATP binding

Biological Process: GTP biosynthetic process; regulation of apoptosis; CTP biosynthetic process; apoptosis; pyrimidine nucleotide metabolic process; UTP biosynthetic process; nucleoside triphosphate biosynthetic process; nucleoside diphosphate phosphorylation; purine nucleotide metabolic process