Mouse anti-Human RASD2 Monoclonal Antibody | anti-RASD2 antibody

RASD2 (GTP-binding Protein Rhes, MGC:4834, Ras Homolog Enriched in Striatum, Rhes, Tumor Endothelial Marker 2, TEM2) APC

Cat. Num. AAA6138631

• Gene Names: RASD2; Rhes; TEM2; MGC:4834
• Reactivity: Human
• Applications: ELISA, Immunoprecipitation, Western Blot
• Purity: Purified by Protein A Affinity Chromatography.
• Synonyms: RASD2; Monoclonal Antibody; RASD2 (GTP-binding Protein Rhes; MGC:4834; Ras Homolog Enriched in Striatum; Rhes; Tumor Endothelial Marker 2; TEM2) APC; anti-RASD2 antibody

• Host: Mouse
• Reactivity: Human
• Clonality: Monoclonal
• Isotype: IgG2b,k
• Clone Number: 1C7
• Specificity: Recognizes human RASD2.
• Purity/Purification: Purified by Protein A Affinity Chromatography.
• Form/Format: Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with Allophycocyanin (APC).

• Applicable Applications for anti-RASD2 antibody: ELISA (EIA), Immunoprecipitation (IP), Western Blot (WB)
• Application Notes: Applications are based on unconjugated antibody.
• Immunogen: Full-length recombinant corresponding to aa1-267 from RASD2 (AAH13419) with GST tag. MW of the GST tag alone is 26kD.
• Immunogen Sequence: MMKTLSSGNCTLSVPAKNSYRMVVLGASRVGKSSIGSRFLNGRFEDQYTPTIEDFHRKVYNIRGDMYQLDILDTSGNHPFPAMRRLSILTGDVFILVFSLDNRESFDEVKRLQKQILEVKSCLKNKTKEAAELPMVICGNKNDHGELCRQVPTTEAELLVSGDENCAYFEVSAKKNTNVDEMFYVLFSMAKLPHEMSPALHRKISVQYGDAFHPRPFCMRRVKEMDAYGMVSPFARRPSVNSDLKYIKAKVLREG
• Conjugate: APC
• Preparation and Storage: Store product at 4 degree C in the dark. DO NOT FREEZE! Stable at 4 degree C for 12 months after receipt as an undiluted liquid. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. Caution: APC conjugates are sensitive to light. For maximum recovery of product, centrifuge the original vial prior to removing the cap.

Western Blot (WB)

(Western Blot detection against Immunogen (54.67kD).)

Western Blot (WB)

(Western Blot analysis of RASD2 expression in transfected 293T cell line by RASD2 monoclonal antibody. Lane 1: RASD2 transfected lysate (30.4kD). Lane 2: Non-transfected lysate.)

Immunoprecipitation (IP)

(Immunoprecipitation of RASD2 transfected lysate using RASD2 monoclonal antibody and Protein A Magnetic Bead, and immunoblotted with RASD2 rabbit polyclonal antibody.)

Product Categories/Family for anti-RASD2 antibody

Antibodies; GTPase; Rab; Ras; Rho Proteins

NCBI and Uniprot Product Information

• NCBI GI #: 33870961
• NCBI GeneID: 23551
• Molecular Weight: 30,366 Da
• NCBI Official Full Name: Homo sapiens RASD family, member 2, mRNA
• NCBI Official Synonym Full Names: RASD family member 2
• NCBI Official Symbol: RASD2
• NCBI Official Synonym Symbols: Rhes; TEM2; MGC:4834
• NCBI Protein Information: GTP-binding protein Rhes
• Protein Family: GTP-binding protein

NCBI Description

This gene belongs to the Ras superfamily of small GTPases and is enriched in the striatum. The encoded protein functions as an E3 ligase for attachment of small ubiquitin-like modifier (SUMO). This protein also binds to mutant huntingtin (mHtt), the protein mutated in Huntington disease (HD). Sumoylation of mHTT by this protein may cause degeneration of the striatum. The protein functions as an activator of mechanistic target of rapamycin 1 (mTOR1), which in turn plays a role in myelination, axon growth and regeneration. Reduced levels of mRNA expressed by this gene were found in HD patients. [provided by RefSeq, Jan 2016]