Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (Western Blot analysis of NME3 expression in transfected 293T cell line by NME3 polyclonal antibody. Lane 1: NME3 transfected lysate (19kD). Lane 2: Non-transfected lysate.)

Rabbit anti-Human NME3 Polyclonal Antibody | anti-NME3 antibody

NME3 (Nucleoside Diphosphate Kinase C, NDPKC, NDPK-C, c371H6.2, DR-nm23, KIAA0516, Nucleoside Diphosphate Kinase 3, NDP Kinase 3, NDK 3, NDK3, NM23H3, nm23-H3) (Biotin)

Gene Names
NME3; NDPKC; NDPK-C; NM23H3; DR-nm23; NM23-H3; c371H6.2
Reactivity
Human
Applications
Western Blot
Purity
Purified by Protein A Affinity Chromatography.
Synonyms
NME3; Polyclonal Antibody; NME3 (Nucleoside Diphosphate Kinase C; NDPKC; NDPK-C; c371H6.2; DR-nm23; KIAA0516; Nucleoside Diphosphate Kinase 3; NDP Kinase 3; NDK 3; NDK3; NM23H3; nm23-H3) (Biotin); anti-NME3 antibody
Ordering
For Research Use Only!
Host
Rabbit
Reactivity
Human
Clonality
Polyclonal
Isotype
IgG
Specificity
Recognizes human NME3.
Purity/Purification
Purified by Protein A Affinity Chromatography.
Form/Format
Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with Biotin.
Applicable Applications for anti-NME3 antibody
Western Blot (WB)
Application Notes
Applications are based on unconjugated antibody.
Immunogen
Full length human NME3, aa1-169 (NP_002504.2).
Immunogen Sequence
MICLVLTIFANLFPAACTGAHERTFLAVKPDGVQRRLVGEIVRRFERKGFKLVALKLVQASEELLREHYAELRERPFYGRLVKYMASGPVVAMVWQGLDVVRTSRALIGATNPADAPPGTIRGDFCIEVGKNLIHGSDSVESARREIALWFRADELLCWEDSAGHWLYE
Conjugate
Biotin
Note
Preservative Free
Preparation and Storage
Store product at 4 degree C if to be used immediately within two weeks. For long-term storage, aliquot to avoid repeated freezing and thawing and store at -20 degree C. Aliquots are stable at -20 degree C for 12 months after receipt. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.

Western Blot (WB)

(Western Blot analysis of NME3 expression in transfected 293T cell line by NME3 polyclonal antibody. Lane 1: NME3 transfected lysate (19kD). Lane 2: Non-transfected lysate.)

Western Blot (WB) (Western Blot analysis of NME3 expression in transfected 293T cell line by NME3 polyclonal antibody. Lane 1: NME3 transfected lysate (19kD). Lane 2: Non-transfected lysate.)
Related Product Information for anti-NME3 antibody
NME3 mRNA is preferentially expressed at early stages of myeloid differentiation of highly purified CD34(+) cells. Its constitutive expression in a myeloid precursor line, which is growth-factor dependent for both proliferation and differentiation, results in inhibition of granulocytic differentiation induced by granulocyte colony-stimulating factor and causes apoptotic cell death. These results appear consistent with a role for the NME3 gene in normal hematopoiesis and raise the possibility that its overexpression contributes to differentiation arrest, a feature of blastic transformation in chronic myelogenous leukemia.
Product Categories/Family for anti-NME3 antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
19,015 Da
NCBI Official Full Name
nucleoside diphosphate kinase 3
NCBI Official Synonym Full Names
NME/NM23 nucleoside diphosphate kinase 3
NCBI Official Symbol
NME3
NCBI Official Synonym Symbols
NDPKC; NDPK-C; NM23H3; DR-nm23; NM23-H3; c371H6.2
NCBI Protein Information
nucleoside diphosphate kinase 3; NDK 3; NDP kinase 3; NDP kinase C; non-metastatic cells 3, protein expressed in; nucleoside diphosphate kinase C
UniProt Protein Name
Nucleoside diphosphate kinase 3
UniProt Gene Name
NME3
UniProt Synonym Gene Names
NDK 3; NDP kinase 3; NDPKC
UniProt Entry Name
NDK3_HUMAN

Uniprot Description

NME3: Major role in the synthesis of nucleoside triphosphates other than ATP. The ATP gamma phosphate is transferred to the NDP beta phosphate via a ping-pong mechanism, using a phosphorylated active-site intermediate. Probably has a role in normal hematopoiesis by inhibition of granulocyte differentiation and induction of apoptosis. Belongs to the NDK family.

Protein type: Kinase, other; Kinase, nucleoside diphosphate; Nucleotide Metabolism - pyrimidine; EC 2.7.4.6; Apoptosis; Motility/polarity/chemotaxis; Nucleotide Metabolism - purine; Other group; NDK family

Chromosomal Location of Human Ortholog: 16q13.3

Cellular Component: mitochondrion; cytosol

Molecular Function: metal ion binding; nucleoside diphosphate kinase activity; ATP binding

Biological Process: GTP biosynthetic process; regulation of apoptosis; CTP biosynthetic process; apoptosis; pyrimidine nucleotide metabolic process; UTP biosynthetic process; nucleoside triphosphate biosynthetic process; nucleoside diphosphate phosphorylation; purine nucleotide metabolic process

Research Articles on NME3

Similar Products

Product Notes

The NME3 nme3 (Catalog #AAA6387152) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The NME3 (Nucleoside Diphosphate Kinase C, NDPKC, NDPK-C, c371H6.2, DR-nm23, KIAA0516, Nucleoside Diphosphate Kinase 3, NDP Kinase 3, NDK 3, NDK3, NM23H3, nm23-H3) (Biotin) reacts with Human and may cross-react with other species as described in the data sheet. AAA Biotech's NME3 can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). Applications are based on unconjugated antibody. Researchers should empirically determine the suitability of the NME3 nme3 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. It is sometimes possible for the material contained within the vial of "NME3, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.