Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Immunohistochemistry (IHC) (Human Smooth Muscle)

Rabbit NLRC4 Polyclonal Antibody | anti-NLRC4 antibody

NLRC4 antibody - C-terminal region

Gene Names
NLRC4; CLAN; IPAF; AIFEC; CLAN1; CLANA; CLANB; CLANC; CLAND; FCAS4; CARD12; CLR2.1
Reactivity
Guinea Pig, Human, Mouse, Rat
Applications
Immunohistochemistry, Western Blot
Purity
Affinity Purified
Synonyms
NLRC4; Polyclonal Antibody; NLRC4 antibody - C-terminal region; anti-NLRC4 antibody
Ordering
For Research Use Only!
Host
Rabbit
Reactivity
Guinea Pig, Human, Mouse, Rat
Clonality
Polyclonal
Specificity
This antibody will recognize NLRC4 isoform 1 (116kD) and isoform 2 (40kD).
Purity/Purification
Affinity Purified
Form/Format
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence
Synthetic peptide located within the following region: QLNLAGNRVSSDGWLAFMGVFENLKQLVFFDFSTKEFLPDPALVRKLSQV
Sequence Length
1024
Applicable Applications for anti-NLRC4 antibody
Immunohistochemistry (IHC), Western Blot (WB)
Homology
Guinea Pig: 80%; Human: 100%; Mouse: 86%; Rat: 80%
Immunogen
The immunogen is a synthetic peptide directed towards the C terminal region of human NLRC4
Preparation and Storage
For short term use, store at 2-8 degree C up to 1 week. For long term storage, store at -20 degree C in small aliquots to prevent freeze-thaw cycles.

Immunohistochemistry (IHC)

(Human Smooth Muscle)

Immunohistochemistry (IHC) (Human Smooth Muscle)

Western Blot (WB)

(WB Suggested Anti-NLRC4 Antibody Titration: 0.2-1 ug/mlELISA Titer: 1:62500Positive Control: HepG2 cell lysate)

Western Blot (WB) (WB Suggested Anti-NLRC4 Antibody Titration: 0.2-1 ug/mlELISA Titer: 1:62500Positive Control: HepG2 cell lysate)
Related Product Information for anti-NLRC4 antibody
This is a rabbit polyclonal antibody against NLRC4. It was validated on Western Blot and immunohistochemistry

Target Description: In C. elegans, Ced4 binds and activates Ced3, an apoptotic initiator caspase, via caspase-associated recruitment domains (CARDs). Human Ced4 homologs include APAF1, NOD1, and NOD2. These proteins have at least 1 N-terminal CARD domain followed by a centrally located nucleotide-binding domain (NBD or NACHT) and a C-terminal regulatory domain, found only in mammals, that contains either WD40 repeats or leucine-rich repeats (LRRs). CARD12 is a member of the Ced4 family and can induce apoptosis.

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
116kDa
NCBI Official Full Name
NLR family CARD domain-containing protein 4 isoform a
NCBI Official Synonym Full Names
NLR family CARD domain containing 4
NCBI Official Symbol
NLRC4
NCBI Official Synonym Symbols
CLAN; IPAF; AIFEC; CLAN1; CLANA; CLANB; CLANC; CLAND; FCAS4; CARD12; CLR2.1
NCBI Protein Information
NLR family CARD domain-containing protein 4
UniProt Protein Name
NLR family CARD domain-containing protein 4
UniProt Gene Name
NLRC4
UniProt Synonym Gene Names
CARD12; CLAN; CLAN1; IPAF; Clan protein; Ipaf
UniProt Entry Name
NLRC4_HUMAN

NCBI Description

This gene encodes a member of the caspase recruitment domain-containing NLR family. Family members play essential roles in innate immune response to a wide range of pathogenic organisms, tissue damage and other cellular stresses. Mutations in this gene result in autoinflammation with infantile enterocolitis. Alternative splicing results in multiple transcript variants. [provided by RefSeq, Oct 2014]

Uniprot Description

NLRC4: Key component of inflammasomes that indirectly senses specific proteins from pathogenic bacteria and fungi and responds by assembling an inflammasome complex that promotes caspase-1 activation, cytokine production and macrophage pyroptosis. 4 isoforms of the human protein are produced by alternative splicing.

Protein type: Apoptosis

Chromosomal Location of Human Ortholog: 2p22.3

Cellular Component: spindle microtubule; cytoplasm; intracellular; nucleus; cytosol

Molecular Function: identical protein binding; protein binding; protein homodimerization activity; ubiquitin-protein ligase activity; magnesium ion binding; cysteine protease inhibitor activity; ATP binding

Biological Process: caspase activation; detection of bacterium; positive regulation of apoptosis; regulation of signal transduction; protein ubiquitination; activation of NF-kappaB transcription factor; regulation of neuron apoptosis; defense response to bacterium; innate immune response; interleukin-1 beta secretion; inflammatory response; activation of innate immune response; protein homooligomerization; negative regulation of apoptosis

Disease: Autoinflammation With Infantile Enterocolitis; Familial Cold Autoinflammatory Syndrome 4

Research Articles on NLRC4

Similar Products

Product Notes

The NLRC4 nlrc4 (Catalog #AAA3224316) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The NLRC4 antibody - C-terminal region reacts with Guinea Pig, Human, Mouse, Rat and may cross-react with other species as described in the data sheet. AAA Biotech's NLRC4 can be used in a range of immunoassay formats including, but not limited to, Immunohistochemistry (IHC), Western Blot (WB). Researchers should empirically determine the suitability of the NLRC4 nlrc4 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: Synthetic peptide located within the following region: QLNLAGNRVS SDGWLAFMGV FENLKQLVFF DFSTKEFLPD PALVRKLSQV. It is sometimes possible for the material contained within the vial of "NLRC4, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.