Rabbit anti-Human NLGN4Y Polyclonal Antibody | anti-NLGN4Y antibody

NLGN4Y (KIAA0951, Neuroligin-4, Y-linked)

Cat. Num. AAA6009551

• Reactivity: Human
• Applications: Western Blot
• Purity: Affinity Purified; Purified by Protein A affinity chromatography.
• Synonyms: NLGN4Y; Polyclonal Antibody; NLGN4Y (KIAA0951; Neuroligin-4; Y-linked); Anti -NLGN4Y (KIAA0951; anti-NLGN4Y antibody

• Host: Rabbit
• Reactivity: Human
• Clonality: Polyclonal
• Isotype: IgG
• Specificity: Recognizes human NLGN4Y.
• Purity/Purification: Affinity Purified; Purified by Protein A affinity chromatography.
• Form/Format: Supplied as a liquid in PBS, pH 7.2.
• Sequence: MLPIWFTTSLDTLMTYVQDQNEDCLYLNIYVPMEDGTNIKRNADDITSNDHGEDKDIHEQNSKKPVMVYIHGGSYMEGTGNMIDGSILASYGNVIVITINYRLGILGMQEARLCGSSKMFNYFKSPFTNLINFF

• Applicable Applications for anti-NLGN4Y antibody: Western Blot (WB)
• Application Notes: Suitable for use in Western Blot.
• Immunogen: Full length human NLGN4Y, aa1-134 (ENSP00000297967).
• Preparation and Storage: May be stored at 4 degree C for short-term only. Aliquot to avoid repeated freezing and thawing. Store at -20 degree C. Aliquots are stable for at least 12 months. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.

Western Blot (WB)

(Western Blot analysis of NLGN4Y expression in transfected 293T cell line by NLGN4Y polyclonal antibody. Lane 1: NLGN4Y transfected lysate (15.2kD). Lane 2: Non-transfected lysate.)

Related Product Information for anti-NLGN4Y antibody

Neuroligins, such as NLGN4Y, are cell adhesion molecules present at the postsynaptic side of the synapse and may be essential for the formation of functional synapses (Jamain et al., 2003 [PubMed 12669065]).

Product Categories/Family for anti-NLGN4Y antibody

Antibodies; Abs to Neuroligins

NCBI and Uniprot Product Information

• NCBI GI #: 332205967
• NCBI GeneID: 22829
• NCBI Accession #: NP_001193779.1
• NCBI GenBank Nucleotide #: NM_001206850.1
• UniProt Accession #: Q8NFZ3; Q14D08; Q7Z3T5; Q8N5B6; Q9Y2F8; F5H6W0
• Molecular Weight: 92,021 Da
• NCBI Official Full Name: neuroligin-4, Y-linked isoform 3
• NCBI Official Synonym Full Names: neuroligin 4, Y-linked
• NCBI Official Symbol: NLGN4Y
• NCBI Protein Information: neuroligin-4, Y-linked
• UniProt Protein Name: Neuroligin-4, Y-linked
• Protein Family: Neuroligin
• UniProt Gene Name: NLGN4Y
• UniProt Synonym Gene Names: KIAA0951; Neuroligin Y
• UniProt Entry Name: NLGNY_HUMAN

NCBI Description

This gene encodes a type I membrane protein that belongs to the family of neuroligins, which are cell adhesion molecules present at the postsynaptic side of the synapse, and may be essential for the formation of functional synapses. Alternatively spliced transcript variants have been found for this gene.[provided by RefSeq, Mar 2011]

Uniprot Description

NLGN4Y: Putative neuronal cell surface protein involved in cell- cell-interactions. Belongs to the type-B carboxylesterase/lipase family. 2 isoforms of the human protein are produced by alternative splicing.

Protein type: Membrane protein, integral

Chromosomal Location of Human Ortholog: Yq11.221

Cellular Component: postsynaptic membrane; extracellular space; cell surface; integral to plasma membrane; postsynaptic density; synapse; cell junction

Molecular Function: protein binding; neurexin binding; cell adhesion molecule binding; receptor activity

Biological Process: regulation of synaptic transmission; synaptogenesis; metabolic process; neuron adhesion; learning; social behavior