Rabbit NFKBIA Polyclonal Antibody | anti-NFKBIA antibody

NFKBIA antibody - middle region

Cat. Num. AAA3224450

• Gene Names: NFKBIA; IKBA; MAD-3; NFKBI; EDAID2
• Reactivity: Cow, Dog, Horse, Human, Mouse, Pig, Rat, Sheep
• Applications: Western Blot
• Purity: Affinity Purified
• Synonyms: NFKBIA; Polyclonal Antibody; NFKBIA antibody - middle region; anti-NFKBIA antibody

• Host: Rabbit
• Reactivity: Cow, Dog, Horse, Human, Mouse, Pig, Rat, Sheep
• Clonality: Polyclonal
• Purity/Purification: Affinity Purified
• Form/Format: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Sequence: Synthetic peptide located within the following region: SPYQLTWGRPSTRIQQQLGQLTLENLQMLPESEDEESYDTESEFTEFTED
• Sequence Length: 317

• Applicable Applications for anti-NFKBIA antibody: Western Blot (WB)
• Homology: Cow: 100%; Dog: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Pig: 100%; Rat: 100%; Sheep: 100%
• Immunogen: The immunogen is a synthetic peptide directed towards the middle region of human NFKBIA
• Preparation and Storage: For short term use, store at 2-8 degree C up to 1 week. For long term storage, store at -20 degree C in small aliquots to prevent freeze-thaw cycles.

Western Blot (WB)

(Lanes:1. 100 ug mouse heart lysate2. 100 ug mouse kidney lysate3. 100 ug mouse lung lysate4. 100 ug mouse thymus lysate5. 100 ug mouse spleen lysatePrimary Antibody Dilution:1:1000Secondary Antibody:Anti-rabbit-APSecondary Antibody Dilution:1:10000Gene Name:NFKBIASubmitted by:Andreia Carvalho, Instituto de Biologia Molecular e Celular, Universidade do Porto (IBMC-UP)/Organelle Biogenesis and Function (OBF) Group)

Western Blot (WB)

(WB Suggested Anti-NFKBIA Antibody Titration: 0.2-1 ug/mlELISA Titer: 1:62500Positive Control: 293T cell lysate)

Related Product Information for anti-NFKBIA antibody

This is a rabbit polyclonal antibody against NFKBIA. It was validated on Western Blot using a cell lysate as a positive control.

Target Description: NFKB1 or NFKB2 is bound to REL, RELA, or RELB to form the NFKB complex. The NFKB complex is inhibited by I-kappa-B proteins (NFKBIA or NFKBIB), which inactivate NF-kappa-B by trapping it in the cytoplasm. Phosphorylation of serine residues on the I-kappa-B proteins by kinases (IKBKA, or IKBKB) marks them for destruction via the ubiquitination pathway, thereby allowing activation of the NF-kappa-B complex. Activated NFKB complex translocates into the nucleus and binds DNA at kappa-B-binding motifs such as 5-prime GGGRNNYYCC 3-prime or 5-prime HGGARNYYCC 3-prime (where H is A, C, or T; R is an A or G purine; and Y is a C or T pyrimidine). NFKB1 (MIM 164011) or NFKB2 (MIM 164012) is bound to REL (MIM 164910), RELA (MIM 164014), or RELB (MIM 604758) to form the NFKB complex. The NFKB complex is inhibited by I-kappa-B proteins (NFKBIA or NFKBIB, MIM 604495), which inactivate NF-kappa-B by trapping it in the cytoplasm. Phosphorylation of serine residues on the I-kappa-B proteins by kinases (IKBKA, MIM 600664, or IKBKB, MIM 603258) marks them for destruction via the ubiquitination pathway, thereby allowing activation of the NF-kappa-B complex. Activated NFKB complex translocates into the nucleus and binds DNA at kappa-B-binding motifs such as 5-prime GGGRNNYYCC 3-prime or 5-prime HGGARNYYCC 3-prime (where H is A, C, or T; R is an A or G purine; and Y is a C or T pyrimidine).[supplied by OMIM]. Publication Note: This RefSeq record includes a subset of the publications that are available for this gene. Please see the Entrez Gene record to access additional publications.

Product Categories/Family for anti-NFKBIA antibody

Polyclonal; Lymphocyte Signaling; Transcription Regulation; Drugs and Drug Metabolism; Cell Biology; Chromatin & Nuclear Signaling; Immunology; Signal Transduction; E3 & Ubiquitin; DNA/RNA/Protein Interactions; Transcription Factors; Cell Differentiation

NCBI and Uniprot Product Information

• NCBI GI #: 10092619
• NCBI GeneID: 4792
• NCBI Accession #: NP_065390
• NCBI GenBank Nucleotide #: NM_020529
• UniProt Accession #: P25963
• Molecular Weight: 35kDa
• NCBI Official Full Name: NF-kappa-B inhibitor alpha
• NCBI Official Synonym Full Names: NFKB inhibitor alpha
• NCBI Official Symbol: NFKBIA
• NCBI Official Synonym Symbols: IKBA; MAD-3; NFKBI; EDAID2
• NCBI Protein Information: NF-kappa-B inhibitor alpha
• UniProt Protein Name: NF-kappa-B inhibitor alpha
• Protein Family: NF-kappa-B inhibitor
• UniProt Gene Name: NFKBIA
• UniProt Synonym Gene Names: IKBA; MAD3; NFKBI; IkB-alpha
• UniProt Entry Name: IKBA_HUMAN

NCBI Description

This gene encodes a member of the NF-kappa-B inhibitor family, which contain multiple ankrin repeat domains. The encoded protein interacts with REL dimers to inhibit NF-kappa-B/REL complexes which are involved in inflammatory responses. The encoded protein moves between the cytoplasm and the nucleus via a nuclear localization signal and CRM1-mediated nuclear export. Mutations in this gene have been found in ectodermal dysplasia anhidrotic with T-cell immunodeficiency autosomal dominant disease. [provided by RefSeq, Aug 2011]

Uniprot Description

IkB-alpha: a regulatory protein that inhibits NF-kappa-B by complexing with and trapping it in the cytoplasm. May be involved in regulation of transcriptional responses to NF-kappa-B, including cell adhesion, immune and proinflammatory responses, apoptosis, differentiation and growth. Controlled by sequential serine-phosphorylation, ubiquitination and degradation.

Protein type: Inhibitor; DNA-binding

Chromosomal Location of Human Ortholog: 14q13

Cellular Component: cytoplasm; plasma membrane; nucleus; cytosol

Molecular Function: identical protein binding; NF-kappaB binding; protein binding; enzyme binding; ubiquitin protein ligase binding; heat shock protein binding; nuclear localization sequence binding; protein complex binding; transcription factor binding

Biological Process: nerve growth factor receptor signaling pathway; viral reproduction; apoptosis; positive regulation of cellular protein metabolic process; toll-like receptor 3 signaling pathway; T cell receptor signaling pathway; activation of NF-kappaB transcription factor; toll-like receptor 10 signaling pathway; toll-like receptor 5 signaling pathway; cytoplasmic sequestering of NF-kappaB; response to exogenous dsRNA; lipopolysaccharide-mediated signaling pathway; positive regulation of interferon type I production; toll-like receptor 4 signaling pathway; cytoplasmic sequestering of transcription factor; negative regulation of myeloid cell differentiation; MyD88-independent toll-like receptor signaling pathway; negative regulation of DNA binding; regulation of NF-kappaB import into nucleus; toll-like receptor 2 signaling pathway; regulation of cell proliferation; MyD88-dependent toll-like receptor signaling pathway; response to muramyl dipeptide; protein import into nucleus, translocation; inhibition of NF-kappaB transcription factor; toll-like receptor signaling pathway; negative regulation of Notch signaling pathway; innate immune response; positive regulation of transcription from RNA polymerase II promoter; toll-like receptor 9 signaling pathway; negative regulation of apoptosis

Disease: Ectodermal Dysplasia, Anhidrotic, With T-cell Immunodeficiency, Autosomal Dominant