Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Immunohistochemistry (IHC) (Human Muscle )

Rabbit NFKB2 Polyclonal Antibody | anti-NFKB2 antibody

NFKB2 antibody - C-terminal region

Gene Names
NFKB2; p52; p100; H2TF1; LYT10; CVID10; LYT-10; NF-kB2; p49/p100
Reactivity
Cow, Horse, Human, Pig, Rabbit, Rat
Applications
Immunohistochemistry, Western Blot
Purity
Affinity Purified
Synonyms
NFKB2; Polyclonal Antibody; NFKB2 antibody - C-terminal region; anti-NFKB2 antibody
Ordering
For Research Use Only!
Host
Rabbit
Reactivity
Cow, Horse, Human, Pig, Rabbit, Rat
Clonality
Polyclonal
Purity/Purification
Affinity Purified
Form/Format
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence
Synthetic peptide located within the following region: SDSDSDSEGPEKDTRSSFRGHTPLDLTCSTLVKTLLLNAAQNTMEPPL
Sequence Length
900
Applicable Applications for anti-NFKB2 antibody
Immunohistochemistry (IHC), Western Blot (WB)
Homology
Cow: 77%; Horse: 85%; Human: 100%; Pig: 77%; Rabbit: 92%; Rat: 77%
Immunogen
The immunogen is a synthetic peptide directed towards the C terminal region of human NFKB2
Preparation and Storage
For short term use, store at 2-8 degree C up to 1 week. For long term storage, store at -20 degree C in small aliquots to prevent freeze-thaw cycles.

Immunohistochemistry (IHC)

(Human Muscle )

Immunohistochemistry (IHC) (Human Muscle )

Immunohistochemistry (IHC)

(Human Smooth Muscle)

Immunohistochemistry (IHC) (Human Smooth Muscle)

Western Blot (WB)

(Host: RabbitTarget Name: NFKB2Sample Tissue: Human HCT116Antibody Dilution: 1.0ug/ml)

Western Blot (WB) (Host: RabbitTarget Name: NFKB2Sample Tissue: Human HCT116Antibody Dilution: 1.0ug/ml)

Western Blot (WB)

(WB Suggested Anti-NFKB2 Antibody Titration: 0.2-1 ug/mlPositive Control: Jurkat cell lysate)

Western Blot (WB) (WB Suggested Anti-NFKB2 Antibody Titration: 0.2-1 ug/mlPositive Control: Jurkat cell lysate)
Related Product Information for anti-NFKB2 antibody
This is a rabbit polyclonal antibody against NFKB2. It was validated on Western Blot and immunohistochemistry

Target Description: NFKB has been detected in numerous cell types that express cytokines, chemokines, growth factors, cell adhesion molecules, and some acute phase proteins in health and in various disease states. NFKB is activated by a wide variety of stimuli such as cytokines, oxidant-free radicals, inhaled particles, ultraviolet irradiation, and bacterial or viral products. Inappropriate activation of NF-kappa-B has been linked to inflammatory events associated with autoimmune arthritis, asthma, septic shock, lung fibrosis, glomerulonephritis, atherosclerosis, and AIDS. In contrast, complete and persistent inhibition of NF-kappa-B has been linked directly to apoptosis, inappropriate immune cell development, and delayed cell growth.

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
97kDa
NCBI Official Full Name
nuclear factor NF-kappa-B p100 subunit isoform a
NCBI Official Synonym Full Names
nuclear factor kappa B subunit 2
NCBI Official Symbol
NFKB2
NCBI Official Synonym Symbols
p52; p100; H2TF1; LYT10; CVID10; LYT-10; NF-kB2; p49/p100
NCBI Protein Information
nuclear factor NF-kappa-B p100 subunit
UniProt Protein Name
Nuclear factor NF-kappa-B p100 subunit
Protein Family
UniProt Gene Name
NFKB2
UniProt Synonym Gene Names
LYT10; Lyt10
UniProt Entry Name
NFKB2_HUMAN

NCBI Description

This gene encodes a subunit of the transcription factor complex nuclear factor-kappa-B (NFkB). The NFkB complex is expressed in numerous cell types and functions as a central activator of genes involved in inflammation and immune function. The protein encoded by this gene can function as both a transcriptional activator or repressor depending on its dimerization partner. The p100 full-length protein is co-translationally processed into a p52 active form. Chromosomal rearrangements and translocations of this locus have been observed in B cell lymphomas, some of which may result in the formation of fusion proteins. There is a pseudogene for this gene on chromosome 18. Alternative splicing results in multiple transcript variants. [provided by RefSeq, Dec 2013]

Uniprot Description

NFkB-p100: a transcription factor of the nuclear factor-kappaB ( NFkB) group. Precursor of the p52 subunit of the nuclear factor NF-kappa-B, which binds to the kappa-B consensus sequence 5'-GGRNNYYCC-3', located in the enhancer region of genes involved in immune response and acute phase reactions. The precursor protein itself does not bind to DNA. LT-beta receptor agonists and LPS induce NF-kappaB/p100 processing to p52 at the level of the ribosome. There are five NFkB proteins in mammals (RelA/NFkB-p65, RelB, c-Rel, NF-_B1/NFkB-p105, and NF-_B2/NFkB-p100). They form a variety of homodimers and heterodimers, each of which activates its own characteristic set of genes. Two spliced isoforms have been identified. Isoform p49 is a subunit of the NF-kappa-B protein complex, which stimulates the HIV enhancer in synergy with p65.

Protein type: Transcription factor; Oncoprotein; DNA-binding

Chromosomal Location of Human Ortholog: 10q24

Cellular Component: Bcl3/NF-kappaB2 complex; nucleoplasm; cytoplasm; cytosol; nucleus

Molecular Function: protein binding; transcription coactivator activity; chromatin binding; transcription factor activity

Biological Process: spleen development; I-kappaB kinase/NF-kappaB cascade; extracellular matrix organization and biogenesis; transcription, DNA-dependent; MyD88-independent toll-like receptor signaling pathway; follicular dendritic cell differentiation; rhythmic process; negative regulation of transcription from RNA polymerase II promoter; toll-like receptor 3 signaling pathway; toll-like receptor 10 signaling pathway; activation of NF-kappaB transcription factor; toll-like receptor 2 signaling pathway; MyD88-dependent toll-like receptor signaling pathway; toll-like receptor 5 signaling pathway; regulation of transcription, DNA-dependent; response to cytokine stimulus; toll-like receptor signaling pathway; germinal center formation; positive regulation of interferon type I production; innate immune response; positive regulation of transcription from RNA polymerase II promoter; toll-like receptor 9 signaling pathway; inflammatory response; toll-like receptor 4 signaling pathway

Disease: Immunodeficiency, Common Variable, 10

Research Articles on NFKB2

Similar Products

Product Notes

The NFKB2 nfkb2 (Catalog #AAA3200725) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The NFKB2 antibody - C-terminal region reacts with Cow, Horse, Human, Pig, Rabbit, Rat and may cross-react with other species as described in the data sheet. AAA Biotech's NFKB2 can be used in a range of immunoassay formats including, but not limited to, Immunohistochemistry (IHC), Western Blot (WB). Researchers should empirically determine the suitability of the NFKB2 nfkb2 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: Synthetic peptide located within the following region: SDSDSDSEGP EKDTRSSFRG HTPLDLTCST LVKTLLLNAA QNTMEPPL. It is sometimes possible for the material contained within the vial of "NFKB2, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.