Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (WB Suggested Anti-NFIB Antibody Titration: 1.25ug/mlPositive Control: Transfected 293T)

Rabbit NFIB Polyclonal Antibody | anti-NFIB antibody

NFIB antibody - middle region

Gene Names
NFIB; CTF; MACID; NF1-B; NFI-B; NFIB2; NFIB3; NF-I/B; NFI-RED; HMGIC/NFIB
Reactivity
Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat, Sheep, Zebrafish
Applications
Western Blot
Purity
Protein A purified
Synonyms
NFIB; Polyclonal Antibody; NFIB antibody - middle region; anti-NFIB antibody
Ordering
For Research Use Only!
Host
Rabbit
Reactivity
Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat, Sheep, Zebrafish
Clonality
Polyclonal
Purity/Purification
Protein A purified
Form/Format
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence
Synthetic peptide located within the following region: QDSGQSGSPSHNDPAKNPPGYLEDSFVKSGVFNVSELVRVSRTPITQGTG
Sequence Length
420
Applicable Applications for anti-NFIB antibody
Western Blot (WB)
Homology
Cow: 100%; Dog: 100%; Guinea Pig: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Rabbit: 100%; Rat: 100%; Sheep: 100%; Zebrafish: 77%
Immunogen
The immunogen is a synthetic peptide directed towards the middle region of human NFIB
Preparation and Storage
For short term use, store at 2-8 degree C up to 1 week. For long term storage, store at -20 degree C in small aliquots to prevent freeze-thaw cycles.

Western Blot (WB)

(WB Suggested Anti-NFIB Antibody Titration: 1.25ug/mlPositive Control: Transfected 293T)

Western Blot (WB) (WB Suggested Anti-NFIB Antibody Titration: 1.25ug/mlPositive Control: Transfected 293T)
Related Product Information for anti-NFIB antibody
This is a rabbit polyclonal antibody against NFIB. It was validated on Western Blot using a cell lysate as a positive control.

Target Description: NFIB is a member of the nuclear factor I family of nuclear proteins, which are known to be involved in viral and cellular transcription. NFIB includes the proposed DNA binding and dimerization domain. NFIB recognizes and binds the palindromic sequence 5'-

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
47kDa
NCBI Official Full Name
nuclear factor 1 B-type isoform 3
NCBI Official Synonym Full Names
nuclear factor I B
NCBI Official Symbol
NFIB
NCBI Official Synonym Symbols
CTF; MACID; NF1-B; NFI-B; NFIB2; NFIB3; NF-I/B; NFI-RED; HMGIC/NFIB
NCBI Protein Information
nuclear factor 1 B-type
UniProt Protein Name
Nuclear factor 1 B-type
Protein Family
UniProt Gene Name
NFIB
UniProt Synonym Gene Names
NF1-B; Nuclear factor 1/B; CTF; NF-I/B; NFI-B
UniProt Entry Name
NFIB_HUMAN

Uniprot Description

NFI-B: Recognizes and binds the palindromic sequence 5'- TTGGCNNNNNGCCAA-3' present in viral and cellular promoters and in the origin of replication of adenovirus type 2. These proteins are individually capable of activating transcription and replication. Belongs to the CTF/NF-I family. 3 isoforms of the human protein are produced by alternative splicing.

Protein type: DNA-binding

Chromosomal Location of Human Ortholog: 9p24.1

Cellular Component: nucleoplasm; nucleolus; nucleus

Molecular Function: DNA binding; double-stranded DNA binding

Biological Process: transcription from RNA polymerase II promoter; pontine nucleus development; glial cell differentiation; anterior commissure morphogenesis; chondrocyte differentiation; positive regulation of transcription from RNA polymerase II promoter; negative regulation of transcription from RNA polymerase II promoter; DNA replication; negative regulation of DNA binding; hindbrain development

Research Articles on NFIB

Similar Products

Product Notes

The NFIB nfib (Catalog #AAA3201118) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The NFIB antibody - middle region reacts with Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat, Sheep, Zebrafish and may cross-react with other species as described in the data sheet. AAA Biotech's NFIB can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). Researchers should empirically determine the suitability of the NFIB nfib for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: Synthetic peptide located within the following region: QDSGQSGSPS HNDPAKNPPG YLEDSFVKSG VFNVSELVRV SRTPITQGTG. It is sometimes possible for the material contained within the vial of "NFIB, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.