Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (WB Suggested Anti-NFAT5 Antibody Titration: 0.2-1 ug/mlELISA Titer: 1:62500Positive Control: MCF7 cell lysate)

Rabbit NFAT5 Polyclonal Antibody | anti-NFAT5 antibody

NFAT5 antibody - middle region

Gene Names
NFAT5; NFATZ; OREBP; NF-AT5; NFATL1; TONEBP
Reactivity
Cow, Dog, Guinea Pig, Horse, Human, Rabbit, Rat
Applications
Western Blot
Purity
Affinity Purified
Synonyms
NFAT5; Polyclonal Antibody; NFAT5 antibody - middle region; anti-NFAT5 antibody
Ordering
For Research Use Only!
Host
Rabbit
Reactivity
Cow, Dog, Guinea Pig, Horse, Human, Rabbit, Rat
Clonality
Polyclonal
Purity/Purification
Affinity Purified
Form/Format
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence
Synthetic peptide located within the following region: PGQPQNEGQPPVTTLLSQQMPENSPLASSINTNQNIEKIDLLVSLQNQGN
Sequence Length
1531
Applicable Applications for anti-NFAT5 antibody
Western Blot (WB)
Homology
Cow: 93%; Dog: 86%; Guinea Pig: 100%; Horse: 86%; Human: 100%; Rabbit: 93%; Rat: 100%
Immunogen
The immunogen is a synthetic peptide directed towards the middle region of human NFAT5
Preparation and Storage
For short term use, store at 2-8 degree C up to 1 week. For long term storage, store at -20 degree C in small aliquots to prevent freeze-thaw cycles.

Western Blot (WB)

(WB Suggested Anti-NFAT5 Antibody Titration: 0.2-1 ug/mlELISA Titer: 1:62500Positive Control: MCF7 cell lysate)

Western Blot (WB) (WB Suggested Anti-NFAT5 Antibody Titration: 0.2-1 ug/mlELISA Titer: 1:62500Positive Control: MCF7 cell lysate)
Related Product Information for anti-NFAT5 antibody
This is a rabbit polyclonal antibody against NFAT5. It was validated on Western Blot using a cell lysate as a positive control.

Target Description: NFAT5 is a member of the nuclear factors of activated T cells family of transcription factors. Proteins belonging to this family play a central role in inducible gene transcription during the immune response. This protein regulates gene expression induced by osmotic stress in mammalian cells. Unlike monomeric members of this protein family, this protein exists as a homodimer and forms stable dimers with DNA elements.The product of this gene is a member of the nuclear factors of activated T cells family of transcription factors. Proteins belonging to this family play a central role in inducible gene transcription during the immune response. This protein regulates gene expression induced by osmotic stress in mammalian cells. Unlike monomeric members of this protein family, this protein exists as a homodimer and forms stable dimers with DNA elements. Multiple transcript variants encoding different isoforms have been found for this gene.

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
166kDa
NCBI Official Full Name
nuclear factor of activated T-cells 5 isoform c
NCBI Official Synonym Full Names
nuclear factor of activated T cells 5
NCBI Official Symbol
NFAT5
NCBI Official Synonym Symbols
NFATZ; OREBP; NF-AT5; NFATL1; TONEBP
NCBI Protein Information
nuclear factor of activated T-cells 5
UniProt Protein Name
Nuclear factor of activated T-cells 5
UniProt Gene Name
NFAT5
UniProt Synonym Gene Names
KIAA0827; TONEBP; NF-AT5; TonE-binding protein; TonEBP
UniProt Entry Name
NFAT5_HUMAN

NCBI Description

The product of this gene is a member of the nuclear factors of activated T cells family of transcription factors. Proteins belonging to this family play a central role in inducible gene transcription during the immune response. This protein regulates gene expression induced by osmotic stress in mammalian cells. Unlike monomeric members of this protein family, this protein exists as a homodimer and forms stable dimers with DNA elements. Multiple transcript variants encoding different isoforms have been found for this gene. [provided by RefSeq, Jul 2008]

Uniprot Description

NFAT5: Plays a role in the inducible expression of genes. Regulates hypertonicity-induced cellular accumulation of osmolytes. Homodimer when bound to DNA, completely encircles its DNA target. Does not bind with Fos and Jun transcription factors. Highest levels in skeletal muscle, brain, heart and peripheral blood leukocytes. Also expressed in placenta, lung, liver, kidney, pancreas, spleen, thymus, prostate, testis, ovary, small intestine and colon. 4 isoforms of the human protein are produced by alternative splicing.

Protein type: Transcription factor

Chromosomal Location of Human Ortholog: 16q22.1

Cellular Component: cytoplasm; nucleus

Molecular Function: protein binding; transcription factor activity

Biological Process: transcription from RNA polymerase II promoter; cytokine production; positive regulation of transcription from RNA polymerase II promoter; excretion; signal transduction

Research Articles on NFAT5

Similar Products

Product Notes

The NFAT5 nfat5 (Catalog #AAA3204299) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The NFAT5 antibody - middle region reacts with Cow, Dog, Guinea Pig, Horse, Human, Rabbit, Rat and may cross-react with other species as described in the data sheet. AAA Biotech's NFAT5 can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). Researchers should empirically determine the suitability of the NFAT5 nfat5 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: Synthetic peptide located within the following region: PGQPQNEGQP PVTTLLSQQM PENSPLASSI NTNQNIEKID LLVSLQNQGN. It is sometimes possible for the material contained within the vial of "NFAT5, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.