Rabbit anti-Human NFAT5 Polyclonal Antibody | anti-NFAT5 antibody

NFAT5 Polyclonal Antibody

Cat. Num. AAA9140958

• Gene Names: NFAT5; NFATZ; OREBP; NF-AT5; NFATL1; TONEBP
• Reactivity: Human
• Applications: Western Blot
• Purity: Affinity Purification
• Synonyms: NFAT5; Polyclonal Antibody; NFAT5 Polyclonal Antibody; NF-AT5; NFATL1; NFATZ; OREBP; TONEBP; nuclear factor of activated T-cells 5; anti-NFAT5 antibody

• Host: Rabbit
• Reactivity: Human
• Clonality: Polyclonal
• Isotype: IgG
• Purity/Purification: Affinity Purification
• Form/Format: PBS with 0.02% sodium azide, 50% glycerol, pH7.3.
• Concentration: 2.06 mg/ml (varies by lot)
• Sequence Length: 1548

• Applicable Applications for anti-NFAT5 antibody: Western Blot (WB)
• Application Notes: WB: 1:500-1:2000
• Immunogen: A synthetic peptide corresponding to a sequence within amino acids 1300 to the C-terminus of human NFAT5 (NP_619728.2).
• Immunogen Sequence: LSPASMSALQTSINQQDMQQSPLYSPQNNMPGIQGATSSPQPQATLFHNTAGGTMNQLQNSPGSSQQTSGMFLFGIQNNCSQLLTSGPATLPDQLMAISQPGQPQNEGQPPVTTLLSQQMPENSPLASSINTNQNIEKIDLLVSLQNQGNNLTGSF
• Positive Samples: SH-SY5Y, A-549
• Preparation and Storage: Store at -20 degree C. Avoid freeze/thaw cycles.

Western Blot (WB)

(Western blot-NFAT5 Polyclonal Antibody)

Related Product Information for anti-NFAT5 antibody

The product of this gene is a member of the nuclear factors of activated T cells family of transcription factors. Proteins belonging to this family play a central role in inducible gene transcription during the immune response. This protein regulates gene expression induced by osmotic stress in mammalian cells. Unlike monomeric members of this protein family, this protein exists as a homodimer and forms stable dimers with DNA elements. Multiple transcript variants encoding different isoforms have been found for this gene.

NCBI and Uniprot Product Information

• NCBI GI #: 164419746
• NCBI GeneID: 10725
• NCBI Accession #: NP_001106649.1
• NCBI GenBank Nucleotide #: NP_001106649.1
• UniProt Accession #: O94916
• Molecular Weight: Calculated: 10kDa; 157kDa; 165kDa; 167kDa; Observed: 174kDa
• NCBI Official Full Name: nuclear factor of activated T-cells 5 isoform d
• NCBI Official Synonym Full Names: nuclear factor of activated T cells 5
• NCBI Official Symbol: NFAT5
• NCBI Official Synonym Symbols: NFATZ; OREBP; NF-AT5; NFATL1; TONEBP
• NCBI Protein Information: nuclear factor of activated T-cells 5
• UniProt Protein Name: Nuclear factor of activated T-cells 5
• Protein Family: Nuclear factor of activated T-cells
• UniProt Gene Name: NFAT5
• UniProt Synonym Gene Names: KIAA0827; TONEBP; NF-AT5; TonE-binding protein; TonEBP
• UniProt Entry Name: NFAT5_HUMAN

NCBI Description

The product of this gene is a member of the nuclear factors of activated T cells family of transcription factors. Proteins belonging to this family play a central role in inducible gene transcription during the immune response. This protein regulates gene expression induced by osmotic stress in mammalian cells. Unlike monomeric members of this protein family, this protein exists as a homodimer and forms stable dimers with DNA elements. Multiple transcript variants encoding different isoforms have been found for this gene. [provided by RefSeq, Jul 2008]

Uniprot Description

NFAT5: Plays a role in the inducible expression of genes. Regulates hypertonicity-induced cellular accumulation of osmolytes. Homodimer when bound to DNA, completely encircles its DNA target. Does not bind with Fos and Jun transcription factors. Highest levels in skeletal muscle, brain, heart and peripheral blood leukocytes. Also expressed in placenta, lung, liver, kidney, pancreas, spleen, thymus, prostate, testis, ovary, small intestine and colon. 4 isoforms of the human protein are produced by alternative splicing.

Protein type: Transcription factor

Chromosomal Location of Human Ortholog: 16q22.1

Cellular Component: cytoplasm; nucleus

Molecular Function: protein binding; transcription factor activity

Biological Process: transcription from RNA polymerase II promoter; cytokine production; positive regulation of transcription from RNA polymerase II promoter; excretion; signal transduction