Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (Western Blot detection against Immunogen (37.84kD).)

Mouse anti-Human ENO2 Monoclonal Antibody | anti-ENO2 antibody

ENO2 (Gamma-enolase, 2-phospho-D-glycerate hydro-lyase, Enolase 2, Neural Enolase, Neuron-specific Enolase, NSE) (PE)

Gene Names
ENO2; NSE; HEL-S-279
Reactivity
Human
Applications
ELISA, Western Blot
Purity
Purified by Protein A Affinity Chromatography.
Synonyms
ENO2; Monoclonal Antibody; ENO2 (Gamma-enolase; 2-phospho-D-glycerate hydro-lyase; Enolase 2; Neural Enolase; Neuron-specific Enolase; NSE) (PE); anti-ENO2 antibody
Ordering
For Research Use Only!
Host
Mouse
Reactivity
Human
Clonality
Monoclonal
Isotype
IgG2a,k
Clone Number
1A3
Specificity
Recognizes human ENO2.
Purity/Purification
Purified by Protein A Affinity Chromatography.
Form/Format
Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with R-Phycoerythrin (PE).
Applicable Applications for anti-ENO2 antibody
ELISA (EIA), Western Blot (WB)
Application Notes
Applications are based on unconjugated antibody.
Immunogen
Partial recombinant corresponding to aa325-434 from human ENO2 (AAH02745) with GST tag. MW of the GST tag alone is 26kD.
Immunogen Sequence
PKRIERAVEEKACNCLLLKVNQIGSVTEAIQACKLAQENGWGVMVSHRSGETEDTFIADLVVGLCTGQIKTGAPCRSERLAKYNQLMRIEEELGDEARFAGHNFRNPSVL
Conjugate
PE
Preparation and Storage
Store product at 4 degree C in the dark. DO NOT FREEZE! Stable at 4 degree C for 12 months after receipt as an undiluted liquid. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. Caution: PE conjugates are sensitive to light. For maximum recovery of product, centrifuge the original vial prior to removing the cap.

Western Blot (WB)

(Western Blot detection against Immunogen (37.84kD).)

Western Blot (WB) (Western Blot detection against Immunogen (37.84kD).)

Western Blot (WB)

(ENO2 monoclonal antibody. Western Blot analysis of ENO2 expression in HeLa.)

Western Blot (WB) (ENO2 monoclonal antibody. Western Blot analysis of ENO2 expression in HeLa.)

Western Blot (WB)

(ENO2 monoclonal antibody. Western Blot analysis of ENO2 expression in different cell lines.)

Western Blot (WB) (ENO2 monoclonal antibody. Western Blot analysis of ENO2 expression in different cell lines.)

Western Blot (WB)

(Western Blot analysis of ENO2 expression in transfected 293T cell line by ENO2 monoclonal antibody. Lane 1: ENO2 transfected lysate (47.3kD). Lane 2: Non-transfected lysate.)

Western Blot (WB) (Western Blot analysis of ENO2 expression in transfected 293T cell line by ENO2 monoclonal antibody. Lane 1: ENO2 transfected lysate (47.3kD). Lane 2: Non-transfected lysate.)

Testing Data

(Detection limit for recombinant GST tagged ENO2 is ~0.1ng/ml as a capture antibody.)

Testing Data (Detection limit for recombinant GST tagged ENO2 is ~0.1ng/ml as a capture antibody.)
Related Product Information for anti-ENO2 antibody
Enolase is a glycolytic enzyme catalyzing the reaction pathway between 2 phospho glycerate and phosphoenol pyruvate. In mammals, enolase molecules are dimers composed of three distinct subunits (alpha, beta and gamma). The alpha subunit is expressed in most tissues and the beta subunit only in muscle. The gamma subunit is expressed primarily in neurons, in normal and in neoplastic neuroendocrine cells. NSE (neuron specific enolase) is found in elevated concentrations in plasma and certain neoplasias. These include pediatric neuroblastoma and small cell lung cancer. Coexpression of NSE and chromogranin A is common in neuroendocrine neoplasms.
Product Categories/Family for anti-ENO2 antibody
References
1. Identification of alpha-Enolase as an Autoantigen in Lung Cancer: Its Overexpression Is Associated with Clinical Outcomes. Chang GC, Liu KJ, Hsieh CL, Hu TS, Charoenfuprasert S, Liu HK, Luh KT, Hsu LH, Wu CW, Ting CC, Chen CY, Chen KC, Yang TY, Chou TY, Wang WH, Whang-Peng J, Shih NY.Clin Cancer Res. 2006 Oct 1;12(19):5746-54.

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
UniProt Accession #
Molecular Weight
42,707 Da
NCBI Official Full Name
Homo sapiens enolase 2 (gamma, neuronal), mRNA
NCBI Official Synonym Full Names
enolase 2
NCBI Official Symbol
ENO2
NCBI Official Synonym Symbols
NSE; HEL-S-279
NCBI Protein Information
gamma-enolase
UniProt Protein Name
Gamma-enolase
Protein Family
UniProt Gene Name
ENO2
UniProt Synonym Gene Names
NSE
UniProt Entry Name
ENOG_HUMAN

NCBI Description

This gene encodes one of the three enolase isoenzymes found in mammals. This isoenzyme, a homodimer, is found in mature neurons and cells of neuronal origin. A switch from alpha enolase to gamma enolase occurs in neural tissue during development in rats and primates. [provided by RefSeq, Jul 2008]

Uniprot Description

ENO2: an enzyme with 2-phospho-D-glycerate hydro-lyase activity. One of the three enolase isoenzymes found in mammals. This isoenzyme, a homodimer, is found in mature neurons and cells of neuronal origin. A switch from alpha enolase to gamma enolase occurs in neural tissue during development in rats and primates.

Protein type: Carbohydrate Metabolism - glycolysis and gluconeogenesis; Lyase; EC 4.2.1.11

Chromosomal Location of Human Ortholog: 12p13

Cellular Component: extracellular space; photoreceptor inner segment; phosphopyruvate hydratase complex; plasma membrane; perikaryon; cytosol

Molecular Function: magnesium ion binding; phosphopyruvate hydratase activity

Biological Process: glycolysis; carbohydrate metabolic process; glucose metabolic process; pathogenesis; gluconeogenesis

Research Articles on ENO2

Similar Products

Product Notes

The ENO2 eno2 (Catalog #AAA6157643) is an Antibody produced from Mouse and is intended for research purposes only. The product is available for immediate purchase. The ENO2 (Gamma-enolase, 2-phospho-D-glycerate hydro-lyase, Enolase 2, Neural Enolase, Neuron-specific Enolase, NSE) (PE) reacts with Human and may cross-react with other species as described in the data sheet. AAA Biotech's ENO2 can be used in a range of immunoassay formats including, but not limited to, ELISA (EIA), Western Blot (WB). Applications are based on unconjugated antibody. Researchers should empirically determine the suitability of the ENO2 eno2 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. It is sometimes possible for the material contained within the vial of "ENO2, Monoclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.