Western Blot (WB)
(Host: RabbitTarget Name: NEMFSample Type: HepG2 Whole Cell lysatesAntibody Dilution: 1.0ug/ml)
Rabbit NEMF Polyclonal Antibody | anti-NEMF antibody
NEMF Antibody - C-terminal region
Gene Names
NEMF; NY-CO-1; SDCCAG1
Reactivity
Cow, Dog, Goat, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat
Applications
Western Blot
Purity
Affinity Purified
Synonyms
NEMF; Polyclonal Antibody; NEMF Antibody - C-terminal region; anti-NEMF antibody
Host
Rabbit
Reactivity
Cow, Dog, Goat, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat
Clonality
Polyclonal
Purity/Purification
Affinity Purified
Form/Format
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence
Synthetic peptide located within the following region: YKVKLTPGVQKKGKAAKTALNSFMHSKEATAREKDLFRSVKDTDLSRNIP
Sequence Length
1076
Applicable Applications for anti-NEMF antibody
Western Blot (WB)
Homology
Cow: 100%; Dog: 100%; Goat: 85%; Guinea Pig: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Rabbit: 100%; Rat: 100%
Immunogen
The immunogen is a synthetic peptide directed towards the C-terminal region of Human NEMF
Preparation and Storage
For short term use, store at 2-8 degree C up to 1 week. For long term storage, store at -20 degree C in small aliquots to prevent freeze-thaw cycles.
Western Blot (WB)
(Host: RabbitTarget Name: NEMFSample Type: HepG2 Whole Cell lysatesAntibody Dilution: 1.0ug/ml)
Western Blot (WB)
(Host: RabbitTarget Name: NEMFSample Type: HepG2 Whole Cell lysatesAntibody Dilution: 1.0ug/ml)
Related Product Information for anti-NEMF antibody
This is a rabbit polyclonal antibody against NEMF. It was validated on Western Blot
Target Description: NEMF plays a role in nuclear export.
Target Description: NEMF plays a role in nuclear export.
Product Categories/Family for anti-NEMF antibody
NCBI and Uniprot Product Information
NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
118kDa
NCBI Official Full Name
nuclear export mediator factor NEMF isoform 1
NCBI Official Synonym Full Names
nuclear export mediator factor
NCBI Official Symbol
NEMF
NCBI Official Synonym Symbols
NY-CO-1; SDCCAG1
NCBI Protein Information
nuclear export mediator factor NEMF
UniProt Protein Name
Nuclear export mediator factor NEMF
Protein Family
UniProt Gene Name
NEMF
UniProt Synonym Gene Names
SDCCAG1
UniProt Entry Name
NEMF_HUMAN
NCBI Description
This gene encodes a component of the ribosome quality control complex. The encoded protein facilitates the recognition and ubiquitination of stalled 60S subunits by the ubiquitin ligase listerin. A similar protein in fly functions as a tumor suppressor. [provided by RefSeq, Jul 2016]
Uniprot Description
SDCCAG1: Plays a role in nuclear export. Belongs to the NEMF family. 5 isoforms of the human protein are produced by alternative splicing.
Protein type: Nuclear export
Chromosomal Location of Human Ortholog: 14q22
Cellular Component: nucleus
Biological Process: nuclear export
Research Articles on NEMF
Similar Products
Product Notes
The NEMF nemf (Catalog #AAA3217581) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The NEMF Antibody - C-terminal region reacts with Cow, Dog, Goat, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat and may cross-react with other species as described in the data sheet. AAA Biotech's NEMF can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). Researchers should empirically determine the suitability of the NEMF nemf for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: Synthetic peptide located within the following region: YKVKLTPGVQ KKGKAAKTAL NSFMHSKEAT AREKDLFRSV KDTDLSRNIP. It is sometimes possible for the material contained within the vial of "NEMF, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.Precautions
All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.Disclaimer
Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.Item has been added to Shopping Cart
If you are ready to order, navigate to Shopping Cart and get ready to checkout.
