Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (Western Blot analysis of NEIL2 expression in transfected 293T cell line by NEIL2 polyclonal antibody. Lane 1: NEIL2 transfected lysate (36.8kD). Lane 2: Non-transfected lysate.)

Rabbit anti-Human NEIL2 Polyclonal Antibody | anti-NEIL2 antibody

NEIL2 (Endonuclease 8-like 2, DNA Glycosylase/AP Lyase Neil2, DNA-(apurinic or apyrimidinic site) Lyase Neil2, Endonuclease VIII-like 2, Nei Homolog 2, Nei-like Protein 2, FLJ31644, MGC2832, MGC4505, NEH2, NEI2)

Gene Names
NEIL2; NEH2; NEI2
Reactivity
Human
Applications
Western Blot, Immunoprecipitation
Purity
Serum
Serum
Synonyms
NEIL2; Polyclonal Antibody; NEIL2 (Endonuclease 8-like 2; DNA Glycosylase/AP Lyase Neil2; DNA-(apurinic or apyrimidinic site) Lyase Neil2; Endonuclease VIII-like 2; Nei Homolog 2; Nei-like Protein 2; FLJ31644; MGC2832; MGC4505; NEH2; NEI2); Anti -NEIL2 (Endonuclease 8-like 2; anti-NEIL2 antibody
Ordering
For Research Use Only!
Host
Rabbit
Reactivity
Human
Clonality
Polyclonal
Isotype
IgG
Specificity
Recognizes human NEIL2.
Purity/Purification
Serum
Serum
Form/Format
Supplied as a liquid.
Sequence
MPEGPLVRKFHHLVSPFVGQQVVKTGGSSKKLQPASLQSLWLQDTQVHGKKLFLRFDLDEEMGPPGSSPTPEPPQKEVQKEGAADPKQVGEPSGQKTLDGSSRSAELVPQGEDDSEYLERDAPAGDAGRWLRVSFGLFGSVWVNDFSRAKKANKRGDWRDPSPRLVLHFGGGGFLAFYNCQLSWSSSPVVTPTCDILSEKFHRGQALEALGQAQPVCYTLLDQRYFSGLGNIIKNEALYRAGIHPLSLGSVLSASRREVLVDHVVEFSTAWLQGKFQGRPQHTQVYQKEQCPAGHQVMKEAFGPEDGLQRLTWWCPQCQPQLSEEPEQCQFS
Applicable Applications for anti-NEIL2 antibody
Western Blot (WB), Immunoprecipitation (IP)
Application Notes
Suitable for use in Western Blot and Immunoprecipitation.
Immunogen
Full length human NEIL2, aa1-332 (NP_659480.1).
Preparation and Storage
May be stored at 4 degree C for short-term only. Aliquot to avoid repeated freezing and thawing. Store at -20 degree C. Aliquots are stable for 12 months. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.

Western Blot (WB)

(Western Blot analysis of NEIL2 expression in transfected 293T cell line by NEIL2 polyclonal antibody. Lane 1: NEIL2 transfected lysate (36.8kD). Lane 2: Non-transfected lysate.)

Western Blot (WB) (Western Blot analysis of NEIL2 expression in transfected 293T cell line by NEIL2 polyclonal antibody. Lane 1: NEIL2 transfected lysate (36.8kD). Lane 2: Non-transfected lysate.)

Immunoprecipitation (IP)

(Immunoprecipitation of NEIL2 transfected lysate using NEIL2 rabbit polyclonal antibody and Protein A Magnetic Bead, and immunoblotted with NEIL2 mouse polyclonal antibody.)

Immunoprecipitation (IP) (Immunoprecipitation of NEIL2 transfected lysate using NEIL2 rabbit polyclonal antibody and Protein A Magnetic Bead, and immunoblotted with NEIL2 mouse polyclonal antibody.)
Related Product Information for anti-NEIL2 antibody
Involved in base excision repair of DNA damaged by oxidation or by mutagenic agents. Has DNA glycosylase activity towards 5-hydroxyuracil and other oxidized derivatives of cytosine with a preference for mismatched double stranded DNA (DNA bubbles). Has low or no DNA glycosylase activity towards thymine glycol, 2-hydroxyadenine, hypoxanthine and 8-oxoguanine. Has AP (apurinic/apyrimidinic) lyase activity and introduces nicks in the DNA strand. Cleaves the DNA backbone by beta-delta elimination to generate a single-strand break at the site of the removed base with both 3'- and 5'-phosphates.
Product Categories/Family for anti-NEIL2 antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
UniProt Accession #
Molecular Weight
36,826 Da
NCBI Official Full Name
NEIL2 protein
NCBI Official Synonym Full Names
nei endonuclease VIII-like 2 (E. coli)
NCBI Official Symbol
NEIL2
NCBI Official Synonym Symbols
NEH2; NEI2
NCBI Protein Information
endonuclease 8-like 2; nei like 2; nei homolog 2; nei-like protein 2; endonuclease VIII-like 2; DNA glycosylase/AP lyase Neil2; DNA-(apurinic or apyrimidinic site) lyase Neil2
UniProt Protein Name
Endonuclease 8-like 2
Protein Family
UniProt Gene Name
NEIL2
UniProt Synonym Gene Names
NEH2
UniProt Entry Name
NEIL2_HUMAN

NCBI Description

NEIL2 belongs to a class of DNA glycosylases homologous to the bacterial Fpg/Nei family. These glycosylases initiate the first step in base excision repair by cleaving bases damaged by reactive oxygen species and introducing a DNA strand break via the associated lyase reaction (Bandaru et al., 2002 [PubMed 12509226])[supplied by OMIM, Mar 2008]

Uniprot Description

Function: Involved in base excision repair of DNA damaged by oxidation or by mutagenic agents. Has DNA glycosylase activity towards 5-hydroxyuracil and other oxidized derivatives of cytosine with a preference for mismatched double-stranded DNA (DNA bubbles). Has low or no DNA glycosylase activity towards thymine glycol, 2-hydroxyadenine, hypoxanthine and 8-oxoguanine. Has AP (apurinic/apyrimidinic) lyase activity and introduces nicks in the DNA strand. Cleaves the DNA backbone by beta-delta elimination to generate a single-strand break at the site of the removed base with both 3'- and 5'-phosphates. Ref.7 Ref.8 Ref.9 Ref.10

Catalytic activity: Removes damaged bases from DNA, leaving an abasic site.The C-O-P bond 3' to the apurinic or apyrimidinic site in DNA is broken by a beta-elimination reaction, leaving a 3'-terminal unsaturated sugar and a product with a terminal 5'-phosphate.

Enzyme regulation: Acetylation of Lys-50 leads to loss of DNA nicking activity. Acetylation of Lys-154 has no effect.

Subunit structure: Binds EP300.

Subcellular location: Nucleus Ref.7.

Tissue specificity: Detected in testis, skeletal muscle, heart, brain, placenta, lung, pancreas, kidney and liver. Ref.7

Domain: The zinc-finger domain is important for DNA binding.

Sequence similarities: Belongs to the FPG family.Contains 1 FPG-type zinc finger.

Research Articles on NEIL2

Similar Products

Product Notes

The NEIL2 neil2 (Catalog #AAA649764) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The NEIL2 (Endonuclease 8-like 2, DNA Glycosylase/AP Lyase Neil2, DNA-(apurinic or apyrimidinic site) Lyase Neil2, Endonuclease VIII-like 2, Nei Homolog 2, Nei-like Protein 2, FLJ31644, MGC2832, MGC4505, NEH2, NEI2) reacts with Human and may cross-react with other species as described in the data sheet. AAA Biotech's NEIL2 can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB), Immunoprecipitation (IP). Suitable for use in Western Blot and Immunoprecipitation. Researchers should empirically determine the suitability of the NEIL2 neil2 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: MPEGPLVRKF HHLVSPFVGQ QVVKTGGSSK KLQPASLQSL WLQDTQVHGK KLFLRFDLDE EMGPPGSSPT PEPPQKEVQK EGAADPKQVG EPSGQKTLDG SSRSAELVPQ GEDDSEYLER DAPAGDAGRW LRVSFGLFGS VWVNDFSRAK KANKRGDWRD PSPRLVLHFG GGGFLAFYNC QLSWSSSPVV TPTCDILSEK FHRGQALEAL GQAQPVCYTL LDQRYFSGLG NIIKNEALYR AGIHPLSLGS VLSASRREVL VDHVVEFSTA WLQGKFQGRP QHTQVYQKEQ CPAGHQVMKE AFGPEDGLQR LTWWCPQCQP QLSEEPEQCQ FS. It is sometimes possible for the material contained within the vial of "NEIL2, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.