Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (Western Blot detection against Immunogen (32.56kD).)

Mouse anti-Human Endothelin A Receptor Monoclonal Antibody | anti-EDNRA antibody

Endothelin A Receptor (Endothelin Receptor Type A, EDNRA, ETA, ET-A, ETAR, ETA-R, ETRA, Endothelin-1 Receptor, hET-AR) APC

Gene Names
EDNRA; ETA; ET-A; ETAR; ETRA; MFDA; ETA-R; hET-AR
Reactivity
Human
Applications
ELISA, Western Blot
Purity
Purified by Protein A Affinity Chromatography.
Synonyms
Endothelin A Receptor; Monoclonal Antibody; Endothelin A Receptor (Endothelin Receptor Type A; EDNRA; ETA; ET-A; ETAR; ETA-R; ETRA; Endothelin-1 Receptor; hET-AR) APC; anti-EDNRA antibody
Ordering
For Research Use Only!
Host
Mouse
Reactivity
Human
Clonality
Monoclonal
Isotype
IgG2a,k
Clone Number
2A5
Specificity
Recognizes human EDNRA.
Purity/Purification
Purified by Protein A Affinity Chromatography.
Form/Format
Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with Allophycocyanin (APC).
Applicable Applications for anti-EDNRA antibody
ELISA (EIA), Western Blot (WB)
Application Notes
Applications are based on unconjugated antibody.
Immunogen
Partial recombinant corresponding to aa18-80 from EDNRA (AAH22511) with GST tag. MW of the GST tag alone is 26kD.
Immunogen Sequence
VISDNPERYSTNLSNHVDDFTTFRGTELSFLVTTHQPTNLVLPSNGSMHNYCPQQTKITSAFK
Conjugate
APC
Preparation and Storage
Store product at 4 degree C in the dark. DO NOT FREEZE! Stable at 4 degree C for 12 months after receipt as an undiluted liquid. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. Caution: APC conjugates are sensitive to light. For maximum recovery of product, centrifuge the original vial prior to removing the cap.

Western Blot (WB)

(Western Blot detection against Immunogen (32.56kD).)

Western Blot (WB) (Western Blot detection against Immunogen (32.56kD).)

Western Blot (WB)

(Western Blot analysis of EDNRA expression in transfected 293T cell line by EDNRA monoclonal antibody. Lane 1: EDNRA transfected lysate (48.7kD). Lane 2: Non-transfected lysate.)

Western Blot (WB) (Western Blot analysis of EDNRA expression in transfected 293T cell line by EDNRA monoclonal antibody. Lane 1: EDNRA transfected lysate (48.7kD). Lane 2: Non-transfected lysate.)

Testing Data

(Detection limit for recombinant GST tagged EDNRA is ~0.1ng/ml as a capture antibody)

Testing Data (Detection limit for recombinant GST tagged EDNRA is ~0.1ng/ml as a capture antibody)
Related Product Information for anti-EDNRA antibody
The ETA receptor is an Endothelin Receptor that mediates the effects of endothelin-1, a mitogen with potent contractile properties. In the Human fetal olfactory epithelium cell line FNC-B4, the ETA receptor increases the secretion of gonadotropin-releasing hormone. Increased ETA concentration may be correlated with smooth muscle hypertrophy observed in patients suffering from bladder-outlet obstruction. ETA receptor has been reported in a variety of tissues including placenta, uterus, testis, heart, adrenal gland, lung, kidney, ovary, skin, liver, bladder, large blood vessels, cerebellum, neurons, and meningioma tumor cells. A splice variant has been identified in melanoma (Zhang et al., 1998). ESTs have been isolated from libraries from the above-mentioned tissues.
Product Categories/Family for anti-EDNRA antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
Molecular Weight
23,803 Da
NCBI Official Full Name
Homo sapiens endothelin receptor type A, mRNA
NCBI Official Synonym Full Names
endothelin receptor type A
NCBI Official Symbol
EDNRA
NCBI Official Synonym Symbols
ETA; ET-A; ETAR; ETRA; MFDA; ETA-R; hET-AR
NCBI Protein Information
endothelin-1 receptor
Protein Family

NCBI Description

This gene encodes the receptor for endothelin-1, a peptide that plays a role in potent and long-lasting vasoconstriction. This receptor associates with guanine-nucleotide-binding (G) proteins, and this coupling activates a phosphatidylinositol-calcium second messenger system. Polymorphisms in this gene have been linked to migraine headache resistance. Alternative splicing results in multiple transcript variants. [provided by RefSeq, Oct 2009]

Research Articles on EDNRA

Similar Products

Product Notes

The EDNRA (Catalog #AAA6136430) is an Antibody produced from Mouse and is intended for research purposes only. The product is available for immediate purchase. The Endothelin A Receptor (Endothelin Receptor Type A, EDNRA, ETA, ET-A, ETAR, ETA-R, ETRA, Endothelin-1 Receptor, hET-AR) APC reacts with Human and may cross-react with other species as described in the data sheet. AAA Biotech's Endothelin A Receptor can be used in a range of immunoassay formats including, but not limited to, ELISA (EIA), Western Blot (WB). Applications are based on unconjugated antibody. Researchers should empirically determine the suitability of the EDNRA for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. It is sometimes possible for the material contained within the vial of "Endothelin A Receptor, Monoclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.