Western Blot (WB)
(Host: RabbitTarget Name: NDUFB11Sample Tissue: Human Lung Tumor lysatesAntibody Dilution: 1ug/ml)
Rabbit anti-Human NDUFB11 Polyclonal Antibody | anti-NDUFB11 antibody
NDUFB11 Antibody - C-terminal region
Gene Names
NDUFB11; ESSS; Np15; P17.3; NP17.3; CI-ESSS; MC1DN30
Reactivity
Human
Applications
Western Blot
Purity
Affinity purified
Synonyms
NDUFB11; Polyclonal Antibody; NDUFB11 Antibody - C-terminal region; anti-NDUFB11 antibody
Host
Rabbit
Reactivity
Human
Clonality
Polyclonal
Purity/Purification
Affinity purified
Form/Format
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 23% sucrose.
Sequence
Synthetic peptide located within the following region: MAAGLFGLSARRLLAAAATRGLPAARVRWESSFSRTVVAPSAVAGKRPPE
Sequence Length
163
Applicable Applications for anti-NDUFB11 antibody
Western Blot (WB)
Homology
Dog: 79%; Horse: 79%; Human: 100%; Rabbit: 79%
Immunogen
The immunogen is a synthetic peptide directed towards the C terminal region of human NDUFB11
Preparation and Storage
For short term use, store at 2-8 degree C up to 1 week. For long term storage, store at -20 degree C in small aliquots to prevent freeze-thaw cycles.
Western Blot (WB)
(Host: RabbitTarget Name: NDUFB11Sample Tissue: Human Lung Tumor lysatesAntibody Dilution: 1ug/ml)
Western Blot (WB)
(Host: RabbitTarget Name: NDUFB11Sample Tissue: Human Lung Tumor lysatesAntibody Dilution: 1ug/ml)
Related Product Information for anti-NDUFB11 antibody
NADH dehydrogenase (ubiquinone) 1 beta subcomplex, 11, 17.3kDa
Target Description: NDUFB11 is a component of mitochondrial complex I. Complex I catalyzes the first step in the electron transport chain, the transfer of 2 electrons from NADH to ubiquinone, coupled to the translocation of 4 protons across the membrane (Carroll et al., 2002 [PubMed 12381726]).[supplied by OMIM, Feb 2009]
Target Description: NDUFB11 is a component of mitochondrial complex I. Complex I catalyzes the first step in the electron transport chain, the transfer of 2 electrons from NADH to ubiquinone, coupled to the translocation of 4 protons across the membrane (Carroll et al., 2002 [PubMed 12381726]).[supplied by OMIM, Feb 2009]
Product Categories/Family for anti-NDUFB11 antibody
NCBI and Uniprot Product Information
NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
17 kDa
NCBI Official Full Name
NADH dehydrogenase
NCBI Official Synonym Full Names
NADH:ubiquinone oxidoreductase subunit B11
NCBI Official Symbol
NDUFB11
NCBI Official Synonym Symbols
ESSS; Np15; P17.3; NP17.3; CI-ESSS; MC1DN30
NCBI Protein Information
NADH dehydrogenase [ubiquinone] 1 beta subcomplex subunit 11, mitochondrial
UniProt Protein Name
NADH dehydrogenase [ubiquinone] 1 beta subcomplex subunit 11, mitochondrial
Protein Family
UniProt Gene Name
NDUFB11
UniProt Synonym Gene Names
CI-ESSS; Np17.3; p17.3
UniProt Entry Name
NDUBB_HUMAN
NCBI Description
The protein encoded by this gene is a subunit of the multisubunit NADH:ubiquinone oxidoreductase (complex I). Mammalian complex I is located at the mitochondrial inner membrane. This protein has NADH dehydrogenase activity and oxidoreductase activity. It transfers electrons from NADH to ubiquinone. Mutations in the human gene are associated with linear skin defects with multiple congenital anomalies 3 and mitochondrial complex I deficiency. [provided by RefSeq, Dec 2016]
Research Articles on NDUFB11
Similar Products
Product Notes
The NDUFB11 ndufb11 (Catalog #AAA3209449) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The NDUFB11 Antibody - C-terminal region reacts with Human and may cross-react with other species as described in the data sheet. AAA Biotech's NDUFB11 can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). Researchers should empirically determine the suitability of the NDUFB11 ndufb11 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: Synthetic peptide located within the following region: MAAGLFGLSA RRLLAAAATR GLPAARVRWE SSFSRTVVAP SAVAGKRPPE. It is sometimes possible for the material contained within the vial of "NDUFB11, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.Precautions
All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.Disclaimer
Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.Item has been added to Shopping Cart
If you are ready to order, navigate to Shopping Cart and get ready to checkout.
