Mouse anti-Human RNPS1 Monoclonal Antibody | anti-RNPS1 antibody

RNPS1 (RNA-binding Protein with Serine-rich Domain 1, E5.1, LDC2, SR-related Protein LDC2)

Cat. Num. AAA6007019

• Gene Names: RNPS1; E5.1
• Reactivity: Human
• Applications: ELISA, Western Blot
• Purity: Affinity Purified; Purified by Protein A affinity chromatography.
• Synonyms: RNPS1; Monoclonal Antibody; RNPS1 (RNA-binding Protein with Serine-rich Domain 1; E5.1; LDC2; SR-related Protein LDC2); Anti -RNPS1 (RNA-binding Protein with Serine-rich Domain 1; anti-RNPS1 antibody

• Host: Mouse
• Reactivity: Human
• Clonality: Monoclonal
• Isotype: IgG2a,k
• Clone Number: 2G11
• Specificity: Recognizes human RNPS1.
• Purity/Purification: Affinity Purified; Purified by Protein A affinity chromatography.
• Form/Format: Supplied as a liquid in PBS, pH 7.2.
• Sequence: PKPTKVHIGRLTRNVTKDHIMEIFSTYGKIKMIDMPVERMHPHLSKGYAYVEFENPDEAEKALKHMDGGQIDGQEITATAVL

• Applicable Applications for anti-RNPS1 antibody: ELISA (EL/EIA), Western Blot (WB)
• Application Notes: Suitable for use in ELISA and Western Blot.
• Immunogen: Partial recombinant corresponding to aa158-240 from human RNPS1 (NP_006702) with GST tag. MW of the GST tag alone is 26kD.
• Preparation and Storage: May be stored at 4 degree C for short-term only. Aliquot to avoid repeated freezing and thawing. Store at -20 degree C. Aliquots are stable for at least 12 months. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.

Western Blot (WB)

(Western Blot detection against Immunogen (35.13kD).)

Product Categories/Family for anti-RNPS1 antibody

Antibodies; Abs to RNA Binding Proteins

NCBI and Uniprot Product Information

• NCBI GI #: 18379334
• NCBI GeneID: 10921
• NCBI Accession #: NP_542161.1
• NCBI GenBank Nucleotide #: NM_080594.2
• UniProt Accession #: Q15287; O75308; Q32P25; Q8WY42; Q9NYG3; A8K1P0; B4DDU8; B4DZU7; B7ZA17
• Molecular Weight: 34,208 Da
• NCBI Official Full Name: RNA-binding protein with serine-rich domain 1
• NCBI Official Synonym Full Names: RNA binding protein S1, serine-rich domain
• NCBI Official Symbol: RNPS1
• NCBI Official Synonym Symbols: E5.1
• NCBI Protein Information: RNA-binding protein with serine-rich domain 1; SR protein; SR-related protein LDC2; RNA-binding protein S1, serine-rich domain
• UniProt Protein Name: RNA-binding protein with serine-rich domain 1
• Protein Family: RNA-binding protein with serine-rich domain
• UniProt Gene Name: RNPS1
• UniProt Synonym Gene Names: LDC2
• UniProt Entry Name: RNPS1_HUMAN

NCBI Description

This gene encodes a protein that is part of a post-splicing multiprotein complex involved in both mRNA nuclear export and mRNA surveillance. mRNA surveillance detects exported mRNAs with truncated open reading frames and initiates nonsense-mediated mRNA decay (NMD). When translation ends upstream from the last exon-exon junction, this triggers NMD to degrade mRNAs containing premature stop codons. This protein binds to the mRNA and remains bound after nuclear export, acting as a nucleocytoplasmic shuttling protein. This protein contains many serine residues. Two splice variants have been found for this gene; both variants encode the same protein. [provided by RefSeq, Jul 2008]

Uniprot Description

RNPS1: a protein that is part of a post-splicing multiprotein complex involved in both mRNA nuclear export and mRNA surveillance. mRNA surveillance detects exported mRNAs with truncated open reading frames and initiates nonsense-mediated mRNA decay (NMD). When translation ends upstream from the last exon-exon junction, this triggers NMD to degrade mRNAs containing premature stop codons. This protein binds to the mRNA and remains bound after nuclear export, acting as a nucleocytoplasmic shuttling protein. This protein contains many serine residues.

Protein type: RNA-binding; RNA processing; RNA splicing; Spliceosome

Chromosomal Location of Human Ortholog: 16p13.3

Cellular Component: nucleoplasm; cytoplasm; nuclear speck; cytosol; nucleus

Molecular Function: protein binding; mRNA 3'-UTR binding; RNA binding; nucleotide binding

Biological Process: transcription from RNA polymerase II promoter; nuclear mRNA splicing, via spliceosome; mRNA export from nucleus; transcription, DNA-dependent; negative regulation of nuclear mRNA splicing, via spliceosome; positive regulation of apoptosis; RNA splicing; mRNA catabolic process, nonsense-mediated decay; gene expression; mRNA 3'-end processing; termination of RNA polymerase II transcription; regulation of alternative nuclear mRNA splicing, via spliceosome