Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (Host: RabbitTarget Name: NDRG4Sample Tissue: Human HepG2 Whole Cell lysatesAntibody Dilution: 1ug/ml)

Rabbit anti-Human NDRG4 Polyclonal Antibody | anti-NDRG4 antibody

NDRG4 Antibody - middle region

Gene Names
NDRG4; BDM1; SMAP8; SMAP-8
Reactivity
Human
Applications
Western Blot
Purity
Affinity purified
Synonyms
NDRG4; Polyclonal Antibody; NDRG4 Antibody - middle region; anti-NDRG4 antibody
Ordering
For Research Use Only!
Host
Rabbit
Reactivity
Human
Clonality
Polyclonal
Purity/Purification
Affinity purified
Form/Format
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence
Synthetic peptide located within the following region: QANLQLFWNMYNSRRDLDINRPGTVPNAKTLRCPVMLVVGDNAPAEDGVV
Sequence Length
352
Applicable Applications for anti-NDRG4 antibody
Western Blot (WB)
Immunogen
The immunogen is a synthetic peptide directed towards the middle region of human NDRG4
Preparation and Storage
For short term use, store at 2-8 degree C up to 1 week. For long term storage, store at -20 degree C in small aliquots to prevent freeze-thaw cycles.

Western Blot (WB)

(Host: RabbitTarget Name: NDRG4Sample Tissue: Human HepG2 Whole Cell lysatesAntibody Dilution: 1ug/ml)

Western Blot (WB) (Host: RabbitTarget Name: NDRG4Sample Tissue: Human HepG2 Whole Cell lysatesAntibody Dilution: 1ug/ml)
Related Product Information for anti-NDRG4 antibody
This gene is a member of the N-myc downregulated gene family which belongs to the alpha/beta hydrolase superfamily. The protein encoded by this gene is a cytoplasmic protein that is required for cell cycle progression and survival in primary astrocytes and may be involved in the regulation of mitogenic signalling in vascular smooth muscles cells. Alternative splicing results in multiple transcripts encoding different isoforms.
Product Categories/Family for anti-NDRG4 antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
38 kDa
NCBI Official Full Name
protein NDRG4 isoform 2
NCBI Official Synonym Full Names
NDRG family member 4
NCBI Official Symbol
NDRG4
NCBI Official Synonym Symbols
BDM1; SMAP8; SMAP-8
NCBI Protein Information
protein NDRG4
UniProt Protein Name
Protein NDRG4
Protein Family
UniProt Gene Name
NDRG4
UniProt Synonym Gene Names
BDM1; KIAA1180; SMAP-8
UniProt Entry Name
NDRG4_HUMAN

NCBI Description

This gene is a member of the N-myc downregulated gene family which belongs to the alpha/beta hydrolase superfamily. The protein encoded by this gene is a cytoplasmic protein that is required for cell cycle progression and survival in primary astrocytes and may be involved in the regulation of mitogenic signalling in vascular smooth muscles cells. Alternative splicing results in multiple transcripts encoding different isoforms.[provided by RefSeq, Jun 2011]

Uniprot Description

NDRG4: Contributes to the maintenance of intracerebral BDNF levels within the normal range, which is necessary for the preservation of spatial learning and the resistance to neuronal cell death caused by ischemic stress. May enhance growth factor-induced ERK1 and ERK2 phosphorylation, including that induced by PDGF and FGF. May attenuate NGF-promoted ELK1 phosphorylation in a microtubule-dependent manner. Expressed predominantly in brain and heart. In the brain, detected in astrocytes. Isoform 1 and isoform 2 are only expressed in brain. Isoform 3 is expressed in both heart and brain. Up-regulated in glioblastoma multiforme cells. Belongs to the NDRG family. 6 isoforms of the human protein are produced by alternative splicing.

Chromosomal Location of Human Ortholog: 16q21

Cellular Component: endoplasmic reticulum membrane; mitochondrion; basolateral plasma membrane; cytoplasm; cytosol

Biological Process: negative regulation of smooth muscle cell proliferation; response to stress; embryonic heart tube development; cardiac muscle cell proliferation; heart looping; negative regulation of smooth muscle cell migration; cell growth; cell differentiation

Research Articles on NDRG4

Similar Products

Product Notes

The NDRG4 ndrg4 (Catalog #AAA3221788) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The NDRG4 Antibody - middle region reacts with Human and may cross-react with other species as described in the data sheet. AAA Biotech's NDRG4 can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). Researchers should empirically determine the suitability of the NDRG4 ndrg4 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: Synthetic peptide located within the following region: QANLQLFWNM YNSRRDLDIN RPGTVPNAKT LRCPVMLVVG DNAPAEDGVV. It is sometimes possible for the material contained within the vial of "NDRG4, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.