Western Blot (WB)
(Host: RabbitTarget Name: MTND4Sample Tissue: Mouse Lung lysatesAntibody Dilution: 1ug/ml)
Rabbit anti-Mouse ND4 Polyclonal Antibody | anti-ND4 antibody
ND4 Antibody - middle region
Gene Names
mt-Nd4; ND4
Reactivity
Mouse
Applications
Western Blot
Purity
Affinity purified
Synonyms
ND4; Polyclonal Antibody; ND4 Antibody - middle region; anti-ND4 antibody
Host
Rabbit
Reactivity
Mouse
Clonality
Polyclonal
Purity/Purification
Affinity purified
Form/Format
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence
Synthetic peptide located within the following region: MIRISIILDPLTKYMAYPFILLSLWGMIMTSSICLRQTDLKSLIAYSSVS
Sequence Length
459
Applicable Applications for anti-ND4 antibody
Western Blot (WB)
Immunogen
The immunogen is a synthetic peptide directed towards the middle terminal region of mouse MTND4
Preparation and Storage
For short term use, store at 2-8 degree C up to 1 week. For long term storage, store at -20 degree C in small aliquots to prevent freeze-thaw cycles.
Western Blot (WB)
(Host: RabbitTarget Name: MTND4Sample Tissue: Mouse Lung lysatesAntibody Dilution: 1ug/ml)
Western Blot (WB)
(Host: RabbitTarget Name: MTND4Sample Tissue: Mouse Lung lysatesAntibody Dilution: 1ug/ml)
Product Categories/Family for anti-ND4 antibody
NCBI and Uniprot Product Information
NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
52 kDa
NCBI Official Full Name
NADH dehydrogenase subunit 4 (mitochondrion)
NCBI Official Synonym Full Names
NADH dehydrogenase 4, mitochondrial
NCBI Official Symbol
mt-Nd4
NCBI Official Synonym Symbols
ND4
NCBI Protein Information
NADH dehydrogenase subunit 4
UniProt Protein Name
NADH-ubiquinone oxidoreductase chain 4
Protein Family
UniProt Gene Name
Mtnd4
UniProt Synonym Gene Names
mt-Nd4; Nd4
Uniprot Description
Core subunit of the mitochondrial membrane respiratory chain NADH dehydrogenase (Complex I) that is believed to belong to the minimal assembly required for catalysis. Complex I functions in the transfer of electrons from NADH to the respiratory chain. The immediate electron acceptor for the enzyme is believed to be ubiquinone ().
Research Articles on ND4
Similar Products
Product Notes
The ND4 mtnd4 (Catalog #AAA3223771) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The ND4 Antibody - middle region reacts with Mouse and may cross-react with other species as described in the data sheet. AAA Biotech's ND4 can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). Researchers should empirically determine the suitability of the ND4 mtnd4 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: Synthetic peptide located within the following region: MIRISIILDP LTKYMAYPFI LLSLWGMIMT SSICLRQTDL KSLIAYSSVS. It is sometimes possible for the material contained within the vial of "ND4, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.Precautions
All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.Disclaimer
Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.Item has been added to Shopping Cart
If you are ready to order, navigate to Shopping Cart and get ready to checkout.
