Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (Host: RabbitTarget Name: SENP2Sample Tissue: Human 293T Whole Cell lysatesAntibody Dilution: 1ug/ml)

Rabbit anti-Human SENP2 Polyclonal Antibody | anti-SENP2 antibody

SENP2 Antibody - middle region

Gene Names
SENP2; AXAM2; SMT3IP2
Reactivity
Human
Applications
Western Blot
Purity
Affinity purified
Synonyms
SENP2; Polyclonal Antibody; SENP2 Antibody - middle region; anti-SENP2 antibody
Ordering
For Research Use Only!
Host
Rabbit
Reactivity
Human
Clonality
Polyclonal
Purity/Purification
Affinity purified
Form/Format
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence
Synthetic peptide located within the following region: GSGSWNNMLKLGNKSPNGISDYPKIRVTVTRDQPRRVLPSFGFTLNSEGC
Sequence Length
589
Applicable Applications for anti-SENP2 antibody
Western Blot (WB)
Immunogen
The immunogen is a synthetic peptide directed towards the middle region of human SENP2
Preparation and Storage
For short term use, store at 2-8 degree C up to 1 week. For long term storage, store at -20 degree C in small aliquots to prevent freeze-thaw cycles.

Western Blot (WB)

(Host: RabbitTarget Name: SENP2Sample Tissue: Human 293T Whole Cell lysatesAntibody Dilution: 1ug/ml)

Western Blot (WB) (Host: RabbitTarget Name: SENP2Sample Tissue: Human 293T Whole Cell lysatesAntibody Dilution: 1ug/ml)
Related Product Information for anti-SENP2 antibody
SUMO1 is a small ubiquitin-like protein that can be covalently conjugated to other proteins. SENP2 is one of a group of enzymes that process newly synthesized SUMO1 into the conjugatable form and catalyze the deconjugation of SUMO1-containing species.
Product Categories/Family for anti-SENP2 antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
64 kDa
NCBI Official Full Name
sentrin-specific protease 2
NCBI Official Synonym Full Names
SUMO specific peptidase 2
NCBI Official Symbol
SENP2
NCBI Official Synonym Symbols
AXAM2; SMT3IP2
NCBI Protein Information
sentrin-specific protease 2
UniProt Protein Name
Sentrin-specific protease 2
Protein Family
UniProt Gene Name
SENP2
UniProt Synonym Gene Names
KIAA1331; Smt3ip2
UniProt Entry Name
SENP2_HUMAN

NCBI Description

SUMO1 (UBL1; MIM 601912) is a small ubiquitin-like protein that can be covalently conjugated to other proteins. SENP2 is one of a group of enzymes that process newly synthesized SUMO1 into the conjugatable form and catalyze the deconjugation of SUMO1-containing species.[supplied by OMIM, Apr 2004]

Uniprot Description

SENP2: Protease that catalyzes two essential functions in the SUMO pathway: processing of full-length SUMO1, SUMO2 and SUMO3 to their mature forms and deconjugation of SUMO1, SUMO2 and SUMO3 from targeted proteins. May down-regulate CTNNB1 levels and thereby modulate the Wnt pathway. Belongs to the peptidase C48 family.

Protein type: Protease; EC 3.4.22.68

Chromosomal Location of Human Ortholog: 3q27.2

Cellular Component: nucleoplasm; PML body; nuclear membrane; nuclear pore; cytoplasmic vesicle

Molecular Function: protein domain specific binding; protein binding; SUMO-specific protease activity

Biological Process: protein desumoylation; mRNA transport; Wnt receptor signaling pathway; heart development; regulation of Wnt receptor signaling pathway; dorsal/ventral axis specification; proteolysis; post-translational protein modification; negative regulation of DNA damage response, signal transduction by p53 class mediator; regulation of DNA endoreduplication; protein transport; protein sumoylation; cellular protein metabolic process; positive regulation of transcription from RNA polymerase II promoter; positive regulation of protein amino acid phosphorylation; negative regulation of protein binding

Research Articles on SENP2

Similar Products

Product Notes

The SENP2 senp2 (Catalog #AAA3223264) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The SENP2 Antibody - middle region reacts with Human and may cross-react with other species as described in the data sheet. AAA Biotech's SENP2 can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). Researchers should empirically determine the suitability of the SENP2 senp2 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: Synthetic peptide located within the following region: GSGSWNNMLK LGNKSPNGIS DYPKIRVTVT RDQPRRVLPS FGFTLNSEGC. It is sometimes possible for the material contained within the vial of "SENP2, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.