Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (Host: RabbitTarget Name: NCAPG2Sample Tissue: Human OVCAR-3 Whole Cell lysatesAntibody Dilution: 1ug/ml)

Rabbit anti-Human NCAPG2 Polyclonal Antibody | anti-NCAPG2 antibody

NCAPG2 Antibody - middle region

Gene Names
NCAPG2; MTB; CAPG2; LUZP5; CAP-G2; hCAP-G2
Reactivity
Human
Applications
Western Blot
Purity
Affinity purified
Synonyms
NCAPG2; Polyclonal Antibody; NCAPG2 Antibody - middle region; anti-NCAPG2 antibody
Ordering
For Research Use Only!
Host
Rabbit
Reactivity
Human
Clonality
Polyclonal
Purity/Purification
Affinity purified
Form/Format
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence
Synthetic peptide located within the following region: HCLNACIQRAVREPPEDEEEEDGREKENVTVLDKTLSVNDVACMAGLLEI
Sequence Length
1143
Applicable Applications for anti-NCAPG2 antibody
Western Blot (WB)
Immunogen
The immunogen is a synthetic peptide directed towards the middle region of human NCAPG2
Preparation and Storage
For short term use, store at 2-8 degree C up to 1 week. For long term storage, store at -20 degree C in small aliquots to prevent freeze-thaw cycles.

Western Blot (WB)

(Host: RabbitTarget Name: NCAPG2Sample Tissue: Human OVCAR-3 Whole Cell lysatesAntibody Dilution: 1ug/ml)

Western Blot (WB) (Host: RabbitTarget Name: NCAPG2Sample Tissue: Human OVCAR-3 Whole Cell lysatesAntibody Dilution: 1ug/ml)
Related Product Information for anti-NCAPG2 antibody
This gene encodes a protein that belongs to the Condensin2nSMC family of proteins. The encoded protein is a regulatory subunit of the condensin II complex which, along with the condensin I complex, plays a role in chromosome assembly and segregation during mitosis. A similar protein in mouse is required for early development of the embryo. Alternate splicing results in multiple transcript variants.
Product Categories/Family for anti-NCAPG2 antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
125 kDa
NCBI Official Full Name
condensin-2 complex subunit G2 isoform a
NCBI Official Synonym Full Names
non-SMC condensin II complex subunit G2
NCBI Official Symbol
NCAPG2
NCBI Official Synonym Symbols
MTB; CAPG2; LUZP5; CAP-G2; hCAP-G2
NCBI Protein Information
condensin-2 complex subunit G2
UniProt Protein Name
Condensin-2 complex subunit G2
Protein Family
UniProt Gene Name
NCAPG2
UniProt Synonym Gene Names
LUZP5; CAP-G2; hCAP-G2
UniProt Entry Name
CNDG2_HUMAN

NCBI Description

This gene encodes a protein that belongs to the Condensin2nSMC family of proteins. The encoded protein is a regulatory subunit of the condensin II complex which, along with the condensin I complex, plays a role in chromosome assembly and segregation during mitosis. A similar protein in mouse is required for early development of the embryo. Alternate splicing results in multiple transcript variants. [provided by RefSeq, Aug 2013]

Uniprot Description

LUZP5: Regulatory subunit of the condensin-2 complex, a complex which establishes mitotic chromosome architecture and is involved in physical rigidity of the chromatid axis. 2 isoforms of the human protein are produced by alternative splicing.

Protein type: Unknown function

Chromosomal Location of Human Ortholog: 7q36.3

Cellular Component: nucleoplasm; membrane; nucleus

Molecular Function: protein binding; methylated histone residue binding

Biological Process: chromosome condensation; mitosis; cell division; mitotic cell cycle; inner cell mass cell proliferation

Research Articles on NCAPG2

Similar Products

Product Notes

The NCAPG2 ncapg2 (Catalog #AAA3222824) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The NCAPG2 Antibody - middle region reacts with Human and may cross-react with other species as described in the data sheet. AAA Biotech's NCAPG2 can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). Researchers should empirically determine the suitability of the NCAPG2 ncapg2 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: Synthetic peptide located within the following region: HCLNACIQRA VREPPEDEEE EDGREKENVT VLDKTLSVND VACMAGLLEI. It is sometimes possible for the material contained within the vial of "NCAPG2, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.