Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (Western blot analysis of extracts of Mouse brain, using NAP1L5 antibody at 1:1000 dilution.Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.Lysates/proteins: 25ug per lane.Blocking buffer: 3% nonfat dry milk in TBST.Detection: ECL Basic Kit (RM00020).Exposure time: 180s.)

Rabbit anti-Mouse NAP1L5 Polyclonal Antibody | anti-NAP1L5 antibody

NAP1L5 Rabbit pAb

Gene Names
NAP1L5; DRLM
Reactivity
Mouse
Applications
Western Blot
Purity
Affinity purification
Synonyms
NAP1L5; Polyclonal Antibody; NAP1L5 Rabbit pAb; DRLM; anti-NAP1L5 antibody
Ordering
For Research Use Only!
Host
Rabbit
Reactivity
Mouse
Clonality
Polyclonal
Isotype
IgG
Purity/Purification
Affinity purification
Form/Format
PBS with 0.02% sodium azide, 50% glycerol, pH7.3.
Sequence
GGAQGGDCDSAAGDPDSAAGQMAEEPQTPAENAPKPKNDFIESLPNSVKCRVLALKKLQKRCDKIEAKFDKEFQALEKKYNDIYKPLLAKI
Applicable Applications for anti-NAP1L5 antibody
Western Blot (WB)
Application Notes
WB: 1:500-1:2000
Immunogen
Recombinant fusion protein containing a sequence corresponding to amino acids 30-120 of human NAP1L5 (NP_715638.1).
Positive Samples
Mouse brain
Preparation and Storage
Store at -20 degree C. Avoid freeze/thaw cycles.

Western Blot (WB)

(Western blot analysis of extracts of Mouse brain, using NAP1L5 antibody at 1:1000 dilution.Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.Lysates/proteins: 25ug per lane.Blocking buffer: 3% nonfat dry milk in TBST.Detection: ECL Basic Kit (RM00020).Exposure time: 180s.)

Western Blot (WB) (Western blot analysis of extracts of Mouse brain, using NAP1L5 antibody at 1:1000 dilution.Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.Lysates/proteins: 25ug per lane.Blocking buffer: 3% nonfat dry milk in TBST.Detection: ECL Basic Kit (RM00020).Exposure time: 180s.)
Related Product Information for anti-NAP1L5 antibody
Background: This gene encodes a protein that shares sequence similarity to nucleosome assembly factors, but may be localized to the cytoplasm rather than the nucleus. Expression of this gene is downregulated in hepatocellular carcinomas. This gene is located within a differentially methylated region (DMR) and is imprinted and paternally expressed. There is a related pseudogene on chromosome 4. [provided by RefSeq, Nov 2015]

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
Predicted: 20 kDa (17kDa in mouse)

Observed: 15 kDa
NCBI Official Full Name
nucleosome assembly protein 1-like 5
NCBI Official Synonym Full Names
nucleosome assembly protein 1-like 5
NCBI Official Symbol
NAP1L5
NCBI Official Synonym Symbols
DRLM
NCBI Protein Information
nucleosome assembly protein 1-like 5; down-regulated in liver malignancy
UniProt Protein Name
Nucleosome assembly protein 1-like 5
UniProt Gene Name
NAP1L5
UniProt Synonym Gene Names
DRLM
UniProt Entry Name
NP1L5_HUMAN

Uniprot Description

NAP1L5: Belongs to the nucleosome assembly protein (NAP) family.

Chromosomal Location of Human Ortholog: 4q22.1|4q21-q22

Cellular Component: nucleus

Biological Process: nucleosome assembly

Research Articles on NAP1L5

Similar Products

Product Notes

The NAP1L5 nap1l5 (Catalog #AAA9143067) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The NAP1L5 Rabbit pAb reacts with Mouse and may cross-react with other species as described in the data sheet. AAA Biotech's NAP1L5 can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). WB: 1:500-1:2000. Researchers should empirically determine the suitability of the NAP1L5 nap1l5 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: GGAQGGDCDS AAGDPDSAAG QMAEEPQTPA ENAPKPKNDF IESLPNSVKC RVLALKKLQK RCDKIEAKFD KEFQALEKKY NDIYKPLLAK I. It is sometimes possible for the material contained within the vial of "NAP1L5, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.