Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (Host: RabbitTarget Name: NANSSample Tissue: Human Neurofibroma Tumor lysatesAntibody Dilution: 1ug/ml)

Rabbit anti-Human NANS Polyclonal Antibody | anti-NANS antibody

NANS Antibody - middle region

Gene Names
NANS; SAS; SEMDG; SEMDCG; HEL-S-100
Reactivity
Human
Applications
Western Blot
Purity
Affinity purified
Synonyms
NANS; Polyclonal Antibody; NANS Antibody - middle region; anti-NANS antibody
Ordering
For Research Use Only!
Host
Rabbit
Reactivity
Human
Clonality
Polyclonal
Purity/Purification
Affinity purified
Form/Format
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence
Synthetic peptide located within the following region: KALERPYTSKHSWGKTYGEHKRHLEFSHDQYRELQRYAEEVGIFFTASGM
Sequence Length
359
Applicable Applications for anti-NANS antibody
Western Blot (WB)
Immunogen
The immunogen is a synthetic peptide directed towards the middle region of human NANS
Preparation and Storage
For short term use, store at 2-8 degree C up to 1 week. For long term storage, store at -20 degree C in small aliquots to prevent freeze-thaw cycles.

Western Blot (WB)

(Host: RabbitTarget Name: NANSSample Tissue: Human Neurofibroma Tumor lysatesAntibody Dilution: 1ug/ml)

Western Blot (WB) (Host: RabbitTarget Name: NANSSample Tissue: Human Neurofibroma Tumor lysatesAntibody Dilution: 1ug/ml)
Related Product Information for anti-NANS antibody
This gene encodes an enzyme that functions in the biosynthetic pathways of sialic acids. In vitro, the encoded protein uses N-acetylmannosamine 6-phosphate and mannose 6-phosphate as substrates to generate phosphorylated forms of N-acetylneuraminic acid (Neu5Ac) and 2-keto-3-deoxy-D-glycero-D-galacto-nononic acid (KDN), respectively; however, it exhibits much higher activity toward the Neu5Ac phosphate product. In insect cells, expression of this gene results in Neu5Ac and KDN production. This gene is related to the E. coli sialic acid synthase gene neuB, and it can partially restore sialic acid synthase activity in an E. coli neuB-negative mutant.
Product Categories/Family for anti-NANS antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
39 kDa
NCBI Official Full Name
sialic acid synthase
NCBI Official Synonym Full Names
N-acetylneuraminate synthase
NCBI Official Symbol
NANS
NCBI Official Synonym Symbols
SAS; SEMDG; SEMDCG; HEL-S-100
NCBI Protein Information
sialic acid synthase
UniProt Protein Name
Sialic acid synthase
Protein Family
UniProt Gene Name
NANS
UniProt Synonym Gene Names
SAS
UniProt Entry Name
SIAS_HUMAN

NCBI Description

This gene encodes an enzyme that functions in the biosynthetic pathways of sialic acids. In vitro, the encoded protein uses N-acetylmannosamine 6-phosphate and mannose 6-phosphate as substrates to generate phosphorylated forms of N-acetylneuraminic acid (Neu5Ac) and 2-keto-3-deoxy-D-glycero-D-galacto-nononic acid (KDN), respectively; however, it exhibits much higher activity toward the Neu5Ac phosphate product. In insect cells, expression of this gene results in Neu5Ac and KDN production. This gene is related to the E. coli sialic acid synthase gene neuB, and it can partially restore sialic acid synthase activity in an E. coli neuB-negative mutant. [provided by RefSeq, Jul 2008]

Uniprot Description

NANS: Produces N-acetylneuraminic acid (Neu5Ac) and 2-keto-3- deoxy-D-glycero-D-galacto-nononic acid (KDN). Can also use N- acetylmannosamine 6-phosphate and mannose 6-phosphate as substrates to generate phosphorylated forms of Neu5Ac and KDN, respectively.

Protein type: EC 2.5.1.57; Carbohydrate Metabolism - amino sugar and nucleotide sugar; Transferase; EC 2.5.1.56

Chromosomal Location of Human Ortholog: 9p24.1-p23

Cellular Component: cytoplasm; cytosol

Molecular Function: N-acylneuraminate-9-phosphate synthase activity; N-acetylneuraminate synthase activity; N-acylneuraminate cytidylyltransferase activity

Biological Process: cellular protein metabolic process; dolichol-linked oligosaccharide biosynthetic process; lipopolysaccharide biosynthetic process; protein amino acid N-linked glycosylation via asparagine; post-translational protein modification

Research Articles on NANS

Similar Products

Product Notes

The NANS nans (Catalog #AAA3221899) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The NANS Antibody - middle region reacts with Human and may cross-react with other species as described in the data sheet. AAA Biotech's NANS can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). Researchers should empirically determine the suitability of the NANS nans for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: Synthetic peptide located within the following region: KALERPYTSK HSWGKTYGEH KRHLEFSHDQ YRELQRYAEE VGIFFTASGM. It is sometimes possible for the material contained within the vial of "NANS, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.