Western Blot (WB)
(Host: RabbitTarget Name: NAE1Sample Tissue: Mouse Heart lysatesAntibody Dilution: 1.0ug/ml)
Rabbit anti-Mouse NAE1 Polyclonal Antibody | anti-NAE1 antibody
NAE1 Antibody - middle region
Gene Names
NAE1; HPP1; ula-1; APPBP1; A-116A10.1
Reactivity
Mouse
Applications
Western Blot
Purity
Affinity purified
Synonyms
NAE1; Polyclonal Antibody; NAE1 Antibody - middle region; anti-NAE1 antibody
Host
Rabbit
Reactivity
Mouse
Clonality
Polyclonal
Purity/Purification
Affinity purified
Form/Format
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence
Synthetic peptide located within the following region: KNENGAPEDEENFEEAIKNVNTALNTTQIPSSIEDIFNDDRCINITKQTP
Sequence Length
534
Applicable Applications for anti-NAE1 antibody
Western Blot (WB)
Immunogen
The immunogen is a synthetic peptide directed towards the middle region of mouse NAE1
Preparation and Storage
For short term use, store at 2-8 degree C up to 1 week. For long term storage, store at -20 degree C in small aliquots to prevent freeze-thaw cycles.
Western Blot (WB)
(Host: RabbitTarget Name: NAE1Sample Tissue: Mouse Heart lysatesAntibody Dilution: 1.0ug/ml)
Western Blot (WB)
(Host: RabbitTarget Name: NAE1Sample Tissue: Mouse Heart lysatesAntibody Dilution: 1.0ug/ml)
Related Product Information for anti-NAE1 antibody
The protein encoded by this gene binds to the beta-amyloid precursor protein. Beta-amyloid precursor protein is a cell surface protein with signal-transducing properties, and it is thought to play a role in the pathogenesis of Alzheimer's disease. In addition, the encoded protein can form a heterodimer with UBE1C and bind and activate NEDD8, a ubiquitin-like protein. This protein is required for cell cycle progression through the S/M checkpoint. Three transcript variants encoding different isoforms have been found for this gene.
Product Categories/Family for anti-NAE1 antibody
NCBI and Uniprot Product Information
NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
Molecular Weight
60 kDa
NCBI Official Full Name
NEDD8-activating enzyme E1 regulatory subunit isoform b
NCBI Official Synonym Full Names
NEDD8 activating enzyme E1 subunit 1
NCBI Official Symbol
NAE1
NCBI Official Synonym Symbols
HPP1; ula-1; APPBP1; A-116A10.1
NCBI Protein Information
NEDD8-activating enzyme E1 regulatory subunit
Protein Family
NCBI Description
The protein encoded by this gene binds to the beta-amyloid precursor protein. Beta-amyloid precursor protein is a cell surface protein with signal-transducing properties, and it is thought to play a role in the pathogenesis of Alzheimer's disease. In addition, the encoded protein can form a heterodimer with UBE1C and bind and activate NEDD8, a ubiquitin-like protein. This protein is required for cell cycle progression through the S/M checkpoint. Three transcript variants encoding different isoforms have been found for this gene. [provided by RefSeq, Jul 2008]
Research Articles on NAE1
Similar Products
Product Notes
The NAE1 (Catalog #AAA3220470) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The NAE1 Antibody - middle region reacts with Mouse and may cross-react with other species as described in the data sheet. AAA Biotech's NAE1 can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). Researchers should empirically determine the suitability of the NAE1 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: Synthetic peptide located within the following region: KNENGAPEDE ENFEEAIKNV NTALNTTQIP SSIEDIFNDD RCINITKQTP. It is sometimes possible for the material contained within the vial of "NAE1, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.Precautions
All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.Disclaimer
Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.Item has been added to Shopping Cart
If you are ready to order, navigate to Shopping Cart and get ready to checkout.
