Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (MYH9 antibody - middle region validated by WB using Hek 293 Whole Cell Lysate at 1:4,000.)

Rabbit MYH9 Polyclonal Antibody | anti-MYH9 antibody

MYH9 antibody - middle region

Gene Names
MYH9; MHA; FTNS; EPSTS; BDPLT6; DFNA17; MATINS; NMMHCA; NMHC-II-A; NMMHC-IIA
Reactivity
Dog, Guinea Pig, Human, Mouse, Pig, Rabbit, Rat
Applications
Western Blot
Purity
Affinity Purified
Synonyms
MYH9; Polyclonal Antibody; MYH9 antibody - middle region; anti-MYH9 antibody
Ordering
For Research Use Only!
Host
Rabbit
Reactivity
Dog, Guinea Pig, Human, Mouse, Pig, Rabbit, Rat
Clonality
Polyclonal
Purity/Purification
Affinity Purified
Form/Format
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence
Synthetic peptide located within the following region: DAMNREVSSLKNKLRRGDLPFVVPRRMARKGAGDGSDEEVDGKADGAEAK
Sequence Length
1960
Applicable Applications for anti-MYH9 antibody
Western Blot (WB)
Homology
Dog: 93%; Guinea Pig: 86%; Human: 100%; Mouse: 86%; Pig: 93%; Rabbit: 86%; Rat: 93%
Immunogen
The immunogen is a synthetic peptide directed towards the middle region of human MYH9
Preparation and Storage
For short term use, store at 2-8 degree C up to 1 week. For long term storage, store at -20 degree C in small aliquots to prevent freeze-thaw cycles.

Western Blot (WB)

(MYH9 antibody - middle region validated by WB using Hek 293 Whole Cell Lysate at 1:4,000.)

Western Blot (WB) (MYH9 antibody - middle region validated by WB using Hek 293 Whole Cell Lysate at 1:4,000.)

Western Blot (WB)

(WB Suggested Anti-MYH9 Antibody Titration: 0.2-1 ug/mlELISA Titer: 1:2500Positive Control: MCF7 cell lysate)

Western Blot (WB) (WB Suggested Anti-MYH9 Antibody Titration: 0.2-1 ug/mlELISA Titer: 1:2500Positive Control: MCF7 cell lysate)
Related Product Information for anti-MYH9 antibody
This is a rabbit polyclonal antibody against MYH9. It was validated on Western Blot using a cell lysate as a positive control.

Target Description: MYH9 is a myosin IIA heavy chain that contains an IQ domain and a myosin head-like domain. The protein is involved in several important functions, including cytokinesis, cell motility and maintenance of cell shape. Defects in MYH9 are the cause of non-syndromic sensorineural deafness autosomal dominant type 17, Epstein syndrome, Alport syndrome with macrothrombocytopenia, Sebastian syndrome, Fechtner syndrome and macrothrombocytopenia with progressive sensorineural deafness.

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
226kDa
NCBI Official Full Name
myosin-9
NCBI Official Synonym Full Names
myosin heavy chain 9
NCBI Official Symbol
MYH9
NCBI Official Synonym Symbols
MHA; FTNS; EPSTS; BDPLT6; DFNA17; MATINS; NMMHCA; NMHC-II-A; NMMHC-IIA
NCBI Protein Information
myosin-9
UniProt Protein Name
Myosin-9
Protein Family
UniProt Gene Name
MYH9
UniProt Synonym Gene Names
NMMHC-A; NMMHC II-a; NMMHC-IIA
UniProt Entry Name
MYH9_HUMAN

NCBI Description

This gene encodes a conventional non-muscle myosin; this protein should not be confused with the unconventional myosin-9a or 9b (MYO9A or MYO9B). The encoded protein is a myosin IIA heavy chain that contains an IQ domain and a myosin head-like domain which is involved in several important functions, including cytokinesis, cell motility and maintenance of cell shape. Defects in this gene have been associated with non-syndromic sensorineural deafness autosomal dominant type 17, Epstein syndrome, Alport syndrome with macrothrombocytopenia, Sebastian syndrome, Fechtner syndrome and macrothrombocytopenia with progressive sensorineural deafness. [provided by RefSeq, Dec 2011]

Uniprot Description

MYH9: Cellular myosin that appears to play a role in cytokinesis, cell shape, and specialized functions such as secretion and capping. Interacts with PDLIM2. Interacts with SLC6A4. Myosin is a hexameric protein that consists of 2 heavy chain subunits (MHC), 2 alkali light chain subunits (MLC) and 2 regulatory light chain subunits (MLC-2). Interacts with RASIP1. Interacts with DDR1. Interacts with SVIL and HTRA3. In the kidney, expressed in the glomeruli. Also expressed in leukocytes. 2 isoforms of the human protein are produced by alternative splicing.

Protein type: Motor; Motility/polarity/chemotaxis; Actin-binding

Chromosomal Location of Human Ortholog: 22q13.1

Cellular Component: cortical cytoskeleton; signalosome; protein complex; myosin II complex; leading edge; contractile ring; immunological synapse; actomyosin; cytosol; actin cytoskeleton; ruffle; cell-cell adherens junction; membrane; cytoplasm; plasma membrane; stress fiber; spindle; uropod; integrin complex; neuromuscular junction; nucleus; cleavage furrow

Molecular Function: actin filament binding; calmodulin binding; microfilament motor activity; protein binding; protein homodimerization activity; protein anchor; ATPase activity; motor activity; actin binding; ADP binding; actin-dependent ATPase activity; ATP binding

Biological Process: integrin-mediated signaling pathway; axon guidance; blood vessel endothelial cell migration; monocyte differentiation; actin filament-based movement; in utero embryonic development; actomyosin structure organization and biogenesis; membrane protein ectodomain proteolysis; cytokinesis; uropod organization and biogenesis; regulation of cell shape; establishment of meiotic spindle localization; protein transport; actin cytoskeleton reorganization; ephrin receptor signaling pathway; establishment of T cell polarity; angiogenesis; platelet formation; leukocyte migration; myoblast fusion; meiotic spindle organization and biogenesis

Disease: Deafness, Autosomal Dominant 17; May-hegglin Anomaly; Fechtner Syndrome; Macrothrombocytopenia And Progressive Sensorineural Deafness; Epstein Syndrome; Sebastian Syndrome

Research Articles on MYH9

Similar Products

Product Notes

The MYH9 myh9 (Catalog #AAA3208846) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The MYH9 antibody - middle region reacts with Dog, Guinea Pig, Human, Mouse, Pig, Rabbit, Rat and may cross-react with other species as described in the data sheet. AAA Biotech's MYH9 can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). Researchers should empirically determine the suitability of the MYH9 myh9 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: Synthetic peptide located within the following region: DAMNREVSSL KNKLRRGDLP FVVPRRMARK GAGDGSDEEV DGKADGAEAK. It is sometimes possible for the material contained within the vial of "MYH9, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.