Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Immunohistochemistry (IHC) (Rabbit Anti-C19orf10 AntibodyFormalin Fixed Paraffin Embedded Tissue: Human Adult LiverObserved Staining: Cytoplasm in hepatocytes, moderate tissue distribution, resemble Golgi structuresPrimary Antibody Concentration: 1:100Secondary Antibody: Donkey anti-Rabbit-Cy3Secondary Antibody Concentration: 1:200Magnification: 20XExposure Time: 0.5 – 2.0 secProtocol located in Reviews and Data.)

Rabbit MYDGF Polyclonal Antibody | anti-MYDGF antibody

MYDGF Antibody - middle region

Gene Names
MYDGF; IL25; IL27; SF20; IL27w; C19orf10; R33729_1; EUROIMAGE1875335
Reactivity
Cow, Dog, Horse, Human, Mouse, Pig, Rat
Applications
Immunohistochemistry, Western Blot
Purity
Affinity Purified
Synonyms
MYDGF; Polyclonal Antibody; MYDGF Antibody - middle region; anti-MYDGF antibody
Ordering
For Research Use Only!
Host
Rabbit
Reactivity
Cow, Dog, Horse, Human, Mouse, Pig, Rat
Clonality
Polyclonal
Purity/Purification
Affinity Purified
Form/Format
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence
Synthetic peptide located within the following region: YASQGGTNEQWQMSLGTSEDHQHFTCTIWRPQGKSYLYFTQFKAEVRGAE
Sequence Length
173
Applicable Applications for anti-MYDGF antibody
Immunohistochemistry (IHC), Western Blot (WB)
Homology
Cow: 100%; Dog: 100%; Horse: 100%; Human: 100%; Mouse: 93%; Pig: 100%; Rat: 100%
Preparation and Storage
For short term use, store at 2-8 degree C up to 1 week. For long term storage, store at -20 degree C in small aliquots to prevent freeze-thaw cycles.

Immunohistochemistry (IHC)

(Rabbit Anti-C19orf10 AntibodyFormalin Fixed Paraffin Embedded Tissue: Human Adult LiverObserved Staining: Cytoplasm in hepatocytes, moderate tissue distribution, resemble Golgi structuresPrimary Antibody Concentration: 1:100Secondary Antibody: Donkey anti-Rabbit-Cy3Secondary Antibody Concentration: 1:200Magnification: 20XExposure Time: 0.5 – 2.0 secProtocol located in Reviews and Data.)

Immunohistochemistry (IHC) (Rabbit Anti-C19orf10 AntibodyFormalin Fixed Paraffin Embedded Tissue: Human Adult LiverObserved Staining: Cytoplasm in hepatocytes, moderate tissue distribution, resemble Golgi structuresPrimary Antibody Concentration: 1:100Secondary Antibody: Donkey anti-Rabbit-Cy3Secondary Antibody Concentration: 1:200Magnification: 20XExposure Time: 0.5 – 2.0 secProtocol located in Reviews and Data.)

Western Blot (WB)

(Host: RabbitTarget Name: C19orf10Antibody Dilution: 1.0ug/mlSample Type: Human Placenta)

Western Blot (WB) (Host: RabbitTarget Name: C19orf10Antibody Dilution: 1.0ug/mlSample Type: Human Placenta)
Related Product Information for anti-MYDGF antibody
This is a rabbit polyclonal antibody against C19orf10. It was validated on Western Blot

Target Description: The protein encoded by this gene was previously thought to support proliferation of lymphoid cells and was considered an interleukin. However, this activity has not been reproducible and the function of this protein is currently unknown.

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
19kDa
NCBI Official Full Name
myeloid-derived growth factor
NCBI Official Synonym Full Names
myeloid derived growth factor
NCBI Official Symbol
MYDGF
NCBI Official Synonym Symbols
IL25; IL27; SF20; IL27w; C19orf10; R33729_1; EUROIMAGE1875335
NCBI Protein Information
myeloid-derived growth factor
UniProt Protein Name
UPF0556 protein C19orf10
UniProt Gene Name
C19orf10
UniProt Synonym Gene Names
IL25; IL-25
UniProt Entry Name
CS010_HUMAN

NCBI Description

The protein encoded by this gene was previously thought to support proliferation of lymphoid cells and was considered an interleukin. However, this activity has not been reproducible and the function of this protein is currently unknown. [provided by RefSeq, Jul 2008]

Uniprot Description

MYDGF: was previously thought to support proliferation of lymphoid cells and was considered an interleukin. However, this activity has not been reproducible and the function of this protein is currently unknown. [provided by RefSeq, Jul 2008]

Protein type: Secreted, signal peptide; Secreted

Chromosomal Location of Human Ortholog: 19p13.3

Cellular Component: extracellular space; endoplasmic reticulum lumen; ER-Golgi intermediate compartment

Biological Process: positive regulation of phosphoinositide 3-kinase cascade; positive regulation of protein kinase B signaling cascade; positive regulation of angiogenesis; unfolded protein response, activation of signaling protein activity; cellular protein metabolic process; positive regulation of MAPKKK cascade; unfolded protein response; positive regulation of transcription from RNA polymerase II promoter; positive regulation of endothelial cell proliferation; positive regulation of protein amino acid phosphorylation; negative regulation of apoptosis

Research Articles on MYDGF

Similar Products

Product Notes

The MYDGF c19orf10 (Catalog #AAA3216241) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The MYDGF Antibody - middle region reacts with Cow, Dog, Horse, Human, Mouse, Pig, Rat and may cross-react with other species as described in the data sheet. AAA Biotech's MYDGF can be used in a range of immunoassay formats including, but not limited to, Immunohistochemistry (IHC), Western Blot (WB). Researchers should empirically determine the suitability of the MYDGF c19orf10 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: Synthetic peptide located within the following region: YASQGGTNEQ WQMSLGTSED HQHFTCTIWR PQGKSYLYFT QFKAEVRGAE. It is sometimes possible for the material contained within the vial of "MYDGF, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.