Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (Western blot-MXD4 Polyclonal Antibody)

Rabbit anti-Mouse MXD4 Polyclonal Antibody | anti-MXD4 antibody

MXD4 Polyclonal Antibody

Gene Names
MXD4; MAD4; MST149; MSTP149; bHLHc12
Reactivity
Mouse
Applications
Western Blot
Purity
Affinity Purification
Synonyms
MXD4; Polyclonal Antibody; MXD4 Polyclonal Antibody; MAD4; MST149; MSTP149; bHLHc12; max dimerization protein 4; anti-MXD4 antibody
Ordering
For Research Use Only!
Host
Rabbit
Reactivity
Mouse
Clonality
Polyclonal
Isotype
IgG
Purity/Purification
Affinity Purification
Form/Format
PBS with 0.02% sodium azide, 50% glycerol, pH7.3.
Concentration
1.79 mg/ml (varies by lot)
Sequence Length
209
Applicable Applications for anti-MXD4 antibody
Western Blot (WB)
Application Notes
WB: 1:500-1:2000
Immunogen
Recombinant fusion protein containing a sequence corresponding to amino acids 110-209 of human MXD4 (NP_006445.1).
Immunogen Sequence
RRALSIKEQLQQEHRFLKRRLEQLSVQSVERVRTDSTGSAVSTDDSEQEVDIEGMEFGPGELDSVGSSSDADDHYSLQSGTGGDSGFGPHCRRLGRPALS
Positive Samples
Mouse Lung
Cellular Location
Nucleus
Preparation and Storage
Store at -20 degree C. Avoid freeze/thaw cycles.

Western Blot (WB)

(Western blot-MXD4 Polyclonal Antibody)

Western Blot (WB) (Western blot-MXD4 Polyclonal Antibody)
Related Product Information for anti-MXD4 antibody
This gene is a member of the MAD gene family. The MAD genes encode basic helix-loop-helix-leucine zipper proteins that heterodimerize with MAX protein, forming a transcriptional repression complex. The MAD proteins compete for MAX binding with MYC, which heterodimerizes with MAX forming a transcriptional activation complex. Studies in rodents suggest that the MAD genes are tumor suppressors and contribute to the regulation of cell growth in differentiating tissues.

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
Calculated: 23kDa
Observed: 30kDa
NCBI Official Full Name
max dimerization protein 4
NCBI Official Synonym Full Names
MAX dimerization protein 4
NCBI Official Symbol
MXD4
NCBI Official Synonym Symbols
MAD4; MST149; MSTP149; bHLHc12
NCBI Protein Information
max dimerization protein 4
UniProt Protein Name
Max dimerization protein 4
Protein Family
UniProt Gene Name
MXD4
UniProt Synonym Gene Names
BHLHC12; MAD4; Max dimerizer 4; bHLHc12
UniProt Entry Name
MAD4_HUMAN

NCBI Description

This gene is a member of the MAD gene family . The MAD genes encode basic helix-loop-helix-leucine zipper proteins that heterodimerize with MAX protein, forming a transcriptional repression complex. The MAD proteins compete for MAX binding with MYC, which heterodimerizes with MAX forming a transcriptional activation complex. Studies in rodents suggest that the MAD genes are tumor suppressors and contribute to the regulation of cell growth in differentiating tissues. [provided by RefSeq, Jul 2008]

Uniprot Description

Mad4: Transcriptional repressor. Binds with MAX to form a sequence-specific DNA-binding protein complex which recognizes the core sequence 5'-CAC[GA]TG-3'. Antagonizes MYC transcriptional activity by competing for MAX and suppresses MYC dependent cell transformation.

Chromosomal Location of Human Ortholog: 4p16.3

Cellular Component: nucleus

Molecular Function: protein dimerization activity; protein binding; DNA binding; transcription corepressor activity

Biological Process: negative regulation of cell proliferation; transcription, DNA-dependent; negative regulation of transcription from RNA polymerase II promoter

Research Articles on MXD4

Similar Products

Product Notes

The MXD4 mxd4 (Catalog #AAA9140875) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The MXD4 Polyclonal Antibody reacts with Mouse and may cross-react with other species as described in the data sheet. AAA Biotech's MXD4 can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). WB: 1:500-1:2000. Researchers should empirically determine the suitability of the MXD4 mxd4 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. It is sometimes possible for the material contained within the vial of "MXD4, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.