Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (Host: RabbitTarget Name: MUSKSample Tissue: Human Du145 Whole Cell lysatesAntibody Dilution: 1ug/ml)

Rabbit anti-Human MUSK Polyclonal Antibody | anti-MUSK antibody

MUSK Antibody - C-terminal region

Gene Names
MUSK; CMS9; FADS
Reactivity
Human
Applications
Western Blot
Purity
Affinity purified
Synonyms
MUSK; Polyclonal Antibody; MUSK Antibody - C-terminal region; anti-MUSK antibody
Ordering
For Research Use Only!
Host
Rabbit
Reactivity
Human
Clonality
Polyclonal
Purity/Purification
Affinity purified
Form/Format
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence
Synthetic peptide located within the following region: MVVKIADFGLSRNIYSADYYKANENDAIPIRWMPPESIFYNRYTTESDVW
Sequence Length
773
Applicable Applications for anti-MUSK antibody
Western Blot (WB)
Immunogen
The immunogen is a synthetic peptide directed towards the C terminal region of human MUSK
Preparation and Storage
For short term use, store at 2-8 degree C up to 1 week. For long term storage, store at -20 degree C in small aliquots to prevent freeze-thaw cycles.

Western Blot (WB)

(Host: RabbitTarget Name: MUSKSample Tissue: Human Du145 Whole Cell lysatesAntibody Dilution: 1ug/ml)

Western Blot (WB) (Host: RabbitTarget Name: MUSKSample Tissue: Human Du145 Whole Cell lysatesAntibody Dilution: 1ug/ml)
Related Product Information for anti-MUSK antibody
This gene encodes a muscle-specific tyrosine kinase receptor. The encoded protein may play a role in clustering of the acetylcholine receptor in the postsynaptic neuromuscular junction. Mutations in this gene have been associated with congenital myasthenic syndrome. Alternatively spliced transcript variants have been described.
Product Categories/Family for anti-MUSK antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
85 kDa
NCBI Official Full Name
muscle, skeletal receptor tyrosine-protein kinase isoform 2
NCBI Official Synonym Full Names
muscle associated receptor tyrosine kinase
NCBI Official Symbol
MUSK
NCBI Official Synonym Symbols
CMS9; FADS
NCBI Protein Information
muscle, skeletal receptor tyrosine-protein kinase
UniProt Protein Name
Muscle, skeletal receptor tyrosine-protein kinase
Protein Family
UniProt Gene Name
MUSK
UniProt Synonym Gene Names
MuSK
UniProt Entry Name
MUSK_HUMAN

NCBI Description

This gene encodes a muscle-specific tyrosine kinase receptor. The encoded protein may play a role in clustering of the acetylcholine receptor in the postsynaptic neuromuscular junction. Mutations in this gene have been associated with congenital myasthenic syndrome. Alternatively spliced transcript variants have been described.[provided by RefSeq, Oct 2009]

Uniprot Description

MUSK: a receptor tyrosine kinase that is essential for the establishment and maintenance of the neuromuscular junction (NMJ). Its activation by agrin, a neuronally derived heparan-sulfate proteoglycan, and the agrin receptor (LRP4), leads to clustering of acetylcholine receptors on the postsynaptic side of the NMJ. Its activation by agrin requires Dok7, which interacts with the cytoplasmic portion of MuSK and activates its tyrosine kinase activity.

Protein type: EC 2.7.10.1; Protein kinase, tyrosine (receptor); Protein kinase, TK; Kinase, protein; Membrane protein, integral; TK group; Musk family

Chromosomal Location of Human Ortholog: 9q31.3-q32

Cellular Component: postsynaptic membrane; integral to plasma membrane; cell junction; neuromuscular junction; receptor complex

Molecular Function: protein binding; protein-tyrosine kinase activity; transmembrane receptor protein tyrosine kinase activity; ATP binding

Biological Process: extracellular matrix organization and biogenesis; peptidyl-tyrosine phosphorylation; regulation of transcription, DNA-dependent; protein amino acid autophosphorylation; positive regulation of neuron apoptosis; multicellular organismal development; regulation of synaptic growth at neuromuscular junction; positive regulation of protein amino acid phosphorylation; cell differentiation; memory; neuromuscular junction development; transmembrane receptor protein tyrosine kinase signaling pathway

Disease: Myasthenic Syndrome, Congenital, 9, Associated With Acetylcholine Receptor Deficiency; Fetal Akinesia Deformation Sequence

Research Articles on MUSK

Similar Products

Product Notes

The MUSK musk (Catalog #AAA3222299) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The MUSK Antibody - C-terminal region reacts with Human and may cross-react with other species as described in the data sheet. AAA Biotech's MUSK can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). Researchers should empirically determine the suitability of the MUSK musk for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: Synthetic peptide located within the following region: MVVKIADFGL SRNIYSADYY KANENDAIPI RWMPPESIFY NRYTTESDVW. It is sometimes possible for the material contained within the vial of "MUSK, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.