Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (Host: RabbitTarget Name: MTSS1Sample Tissue: Human HT1080 Whole CellAntibody Dilution: 1.0ug/ml)

Rabbit anti-Human MTSS1 Polyclonal Antibody | anti-MTSS1 antibody

MTSS1 Antibody - middle region

Gene Names
MTSS1; MIM; MIMA; MIMB
Reactivity
Human
Applications
Western Blot
Purity
Affinity purified
Synonyms
MTSS1; Polyclonal Antibody; MTSS1 Antibody - middle region; anti-MTSS1 antibody
Ordering
For Research Use Only!
Host
Rabbit
Reactivity
Human
Clonality
Polyclonal
Purity/Purification
Affinity purified
Form/Format
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence
Synthetic peptide located within the following region: KDWAKPGPYDQPLVNTLQRRKEKREPDPNGGGPTTASGPPAAAEEAQRPR
Sequence Length
167
Applicable Applications for anti-MTSS1 antibody
Western Blot (WB)
Immunogen
The immunogen is a synthetic peptide directed towards the middle region of human MTSS1
Preparation and Storage
For short term use, store at 2-8 degree C up to 1 week. For long term storage, store at -20 degree C in small aliquots to prevent freeze-thaw cycles.

Western Blot (WB)

(Host: RabbitTarget Name: MTSS1Sample Tissue: Human HT1080 Whole CellAntibody Dilution: 1.0ug/ml)

Western Blot (WB) (Host: RabbitTarget Name: MTSS1Sample Tissue: Human HT1080 Whole CellAntibody Dilution: 1.0ug/ml)
Product Categories/Family for anti-MTSS1 antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
82 kDa
NCBI Official Full Name
metastasis suppressor protein 1 isoform 2
NCBI Official Synonym Full Names
MTSS I-BAR domain containing 1
NCBI Official Symbol
MTSS1
NCBI Official Synonym Symbols
MIM; MIMA; MIMB
NCBI Protein Information
metastasis suppressor protein 1
UniProt Protein Name
Metastasis suppressor protein 1
Protein Family
UniProt Gene Name
MTSS1
UniProt Synonym Gene Names
KIAA0429; MIM
UniProt Entry Name
MTSS1_HUMAN

Uniprot Description

MTSS1: an intracellular protein that binds to actin and cortactin, and possesses tumor suppressor activity. Binds to the cytoplasmic domain of receptor protein tyrosine phosphatase delta. Senses and induces curved membranous curvatures important for cellular polarization, mobilization and endocytosis. May be related to cancer progression or tumor metastasis in a variety of organ sites. Its expression is down-regulated by MiR-135a. Downregulated in prostate cancer. Expressed in many tissues, including spleen, thymus, prostate, testis, uterus, colon, and peripheral blood. Belongs to the MTSS1 family. Three isoforms of the human protein are produced by alternative splicing.

Protein type: Tumor suppressor; Adaptor/scaffold; Motility/polarity/chemotaxis

Chromosomal Location of Human Ortholog: 8p22

Cellular Component: ruffle; adherens junction; endocytic vesicle; cytoplasm; actin cytoskeleton

Molecular Function: actin monomer binding; actin filament binding; identical protein binding; protein binding; receptor binding

Biological Process: plasma membrane organization and biogenesis; in utero embryonic development; actin filament polymerization; microspike biogenesis; positive regulation of actin filament bundle formation; cell motility; cell adhesion; actin cytoskeleton organization and biogenesis; bone mineralization; transmembrane receptor protein tyrosine kinase signaling pathway; negative regulation of epithelial cell proliferation

Research Articles on MTSS1

Similar Products

Product Notes

The MTSS1 mtss1 (Catalog #AAA3220506) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The MTSS1 Antibody - middle region reacts with Human and may cross-react with other species as described in the data sheet. AAA Biotech's MTSS1 can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). Researchers should empirically determine the suitability of the MTSS1 mtss1 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: Synthetic peptide located within the following region: KDWAKPGPYD QPLVNTLQRR KEKREPDPNG GGPTTASGPP AAAEEAQRPR. It is sometimes possible for the material contained within the vial of "MTSS1, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.