Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (WB Suggested Anti-MTR Antibody Titration: 0.2-1 ug/mlPositive Control: 721_B cell lysateMTR is supported by BioGPS gene expression data to be expressed in 721_B)

Rabbit MTR Polyclonal Antibody | anti-MTR antibody

MTR antibody - C-terminal region

Gene Names
MTR; MS; HMAG; cblG
Reactivity
Cow, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat
Applications
Western Blot
Purity
Affinity Purified
Synonyms
MTR; Polyclonal Antibody; MTR antibody - C-terminal region; anti-MTR antibody
Ordering
For Research Use Only!
Host
Rabbit
Reactivity
Cow, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat
Clonality
Polyclonal
Purity/Purification
Affinity Purified
Form/Format
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence
Synthetic peptide located within the following region: GSEQLDVADLRRLRYKGIRPAPGYPSQPDHTEKLTMWRLADIEQSTGIRL
Sequence Length
1265
Applicable Applications for anti-MTR antibody
Western Blot (WB)
Homology
Cow: 100%; Guinea Pig: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Rabbit: 100%; Rat: 100%
Immunogen
The immunogen is a synthetic peptide directed towards the C terminal region of human MTR
Preparation and Storage
For short term use, store at 2-8 degree C up to 1 week. For long term storage, store at -20 degree C in small aliquots to prevent freeze-thaw cycles.

Western Blot (WB)

(WB Suggested Anti-MTR Antibody Titration: 0.2-1 ug/mlPositive Control: 721_B cell lysateMTR is supported by BioGPS gene expression data to be expressed in 721_B)

Western Blot (WB) (WB Suggested Anti-MTR Antibody Titration: 0.2-1 ug/mlPositive Control: 721_B cell lysateMTR is supported by BioGPS gene expression data to be expressed in 721_B)
Related Product Information for anti-MTR antibody
This is a rabbit polyclonal antibody against MTR. It was validated on Western Blot using a cell lysate as a positive control.

Target Description: MTR is the enzyme 5-methyltetrahydrofolate-homocysteine methyltransferase. This enzyme, also known as cobalamin-dependent methionine synthase, catalyzes the final step in methionine biosynthesis. Mutations in MTR have been identified as the underlying cause of methylcobalamin deficiency complementation group G. MTR encodes the enzyme 5-methyltetrahydrofolate-homocysteine methyltransferase. This enzyme, also known as cobalamin-dependent methionine synthase, catalyzes the final step in methionine biosynthesis. Mutations in MTR have been identified as the underlying cause of methylcobalamin deficiency complementation group G. Sequence Note: This RefSeq record was created from transcript and genomic sequence data because no single transcript was available for the full length of the gene. The extent of this transcript is supported by transcript alignments. Publication Note: This RefSeq record includes a subset of the publications that are available for this gene. Please see the Entrez Gene record to access additional publications.

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
140kDa
NCBI Official Full Name
methionine synthase isoform 1
NCBI Official Synonym Full Names
5-methyltetrahydrofolate-homocysteine methyltransferase
NCBI Official Symbol
MTR
NCBI Official Synonym Symbols
MS; HMAG; cblG
NCBI Protein Information
methionine synthase
UniProt Protein Name
Methionine synthase
Protein Family
UniProt Gene Name
MTR
UniProt Synonym Gene Names
MS
UniProt Entry Name
METH_HUMAN

NCBI Description

This gene encodes the 5-methyltetrahydrofolate-homocysteine methyltransferase. This enzyme, also known as cobalamin-dependent methionine synthase, catalyzes the final step in methionine biosynthesis. Mutations in MTR have been identified as the underlying cause of methylcobalamin deficiency complementation group G. Alternatively spliced transcript variants encoding distinct isoforms have been found for this gene. [provided by RefSeq, May 2014]

Uniprot Description

MTR: Catalyzes the transfer of a methyl group from methyl- cobalamin to homocysteine, yielding enzyme-bound cob(I)alamin and methionine. Subsequently, remethylates the cofactor using methyltetrahydrofolate. Defects in MTR are the cause of methylcobalamin deficiency type G (cblG); also known as homocystinuria-megaloblastic anemia complementation type G. It is an autosomal recessive inherited disease that causes mental retardation, macrocytic anemia, and homocystinuria. Mild deficiency in MS activity could be associated with mild hyperhomocysteinemia, a risk factor for cardiovascular disease and possibly neural tube defects. MS mutations could also be involved in tumorigenesis. Defects in MTR may be a cause of susceptibility to folate-sensitive neural tube defects (FS-NTD). The most common NTDs are open spina bifida (myelomeningocele) and anencephaly. Genetic defects in MTR may affect the risk of spina bifida via the maternal rather than the embryonic genotype. Belongs to the vitamin-B12 dependent methionine synthase family.

Protein type: Cofactor and Vitamin Metabolism - one carbon pool by folate; Methyltransferase; EC 2.1.1.13; Amino Acid Metabolism - cysteine and methionine

Chromosomal Location of Human Ortholog: 1q43

Cellular Component: cytoplasm; cytosol

Molecular Function: protein binding; homocysteine S-methyltransferase activity; zinc ion binding; methionine synthase activity; cobalamin binding

Biological Process: methylation; nervous system development; vitamin metabolic process; methionine biosynthetic process; sulfur amino acid metabolic process; cobalamin metabolic process; xenobiotic metabolic process; pteridine and derivative metabolic process; water-soluble vitamin metabolic process

Disease: Homocystinuria-megaloblastic Anemia, Cblg Complementation Type; Neural Tube Defects, Folate-sensitive

Research Articles on MTR

Similar Products

Product Notes

The MTR mtr (Catalog #AAA3209031) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The MTR antibody - C-terminal region reacts with Cow, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat and may cross-react with other species as described in the data sheet. AAA Biotech's MTR can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). Researchers should empirically determine the suitability of the MTR mtr for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: Synthetic peptide located within the following region: GSEQLDVADL RRLRYKGIRP APGYPSQPDH TEKLTMWRLA DIEQSTGIRL. It is sometimes possible for the material contained within the vial of "MTR, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.