Mouse anti-Human KBTBD9 Polyclonal Antibody | anti-KLHL29 antibody

KBTBD9 (Kelch-like Protein 29, Kelch Repeat and BTB Domain-containing Protein 9, KLHL29, KBTBD9, KIAA1921)

Cat. Num. AAA6003218

• Gene Names: KLHL29; KBTBD9
• Reactivity: Human
• Applications: Western Blot, Immunofluorescence
• Purity: Affinity Purified; Purified by Protein A affinity chromatography.
• Synonyms: KBTBD9; Polyclonal Antibody; KBTBD9 (Kelch-like Protein 29; Kelch Repeat and BTB Domain-containing Protein 9; KLHL29; KIAA1921); Anti -KBTBD9 (Kelch-like Protein 29; anti-KLHL29 antibody

• Host: Mouse
• Reactivity: Human
• Clonality: Polyclonal
• Isotype: IgG
• Specificity: Recognizes human KBTBD9.
• Purity/Purification: Affinity Purified; Purified by Protein A affinity chromatography.
• Form/Format: Supplied as a liquid in PBS, pH 7.2.
• Sequence: MPGHYSLPQPPSQPLSSVVVNMPAQALYASPQPLAVSTLPGVGQVARPGPTAVGNGHMAGPLLPPPPPAQPSATLPSGAPATNGPPTTDSAHGLQMLRTIGVGKYEFTDPGHPREMLKELNQQRRAKAFTDLKIVVEGREFEVHQNVLASCSLYFKDLIQRSVQDSGQGGREKLELVLSNLQADVLELLLEFVYTGSLVIDSANAKTLLEAASKFQFHTFCKVCVSFLEKQLTASNCLGVLAMAEAMQCSELYHMAKAFALQIFPEVAAQEEILSISKDDFIAYVSNDSLNTKAEELVYETVIKWIKKDPATRTQYAAELLAVVRLPFIHPSYLLNVVDNEELIKSSEACRDLVNEAKRYHMLPHARQEMQTPRTRPRLSAGVAEVIVLVGGRQMVGMTQRSLVAVTCWNPQNNKWYPLASLPFYDREFFSVVSAGDNIYLSGGMESGVTLADVWCYMSLLDNWNLVSRMTVPRCRHNSLVYDGKIYTLGGLGVAGNVDHVER

• Applicable Applications for anti-KLHL29 antibody: Western Blot (WB), Immunofluorescence (IF)
• Application Notes: Suitable for use in Immunofluorescence and Western Blot.; Dilution: Immunofluorescence: 10ug/ml
• Immunogen: Full length human KBTBD9, aa1-503 (AAH15667).
• Preparation and Storage: May be stored at 4 degree C for short-term only. Aliquot to avoid repeated freezing and thawing. Store at -20 degree C. Aliquots are stable for at least 12 months. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.

Western Blot (WB)

(Western Blot analysis of KBTBD9 expression in transfected 293T cell line by KBTBD9 polyclonal antibody. Lane 1: KBTBD9 transfected lysate (55.33kD). Lane 2: Non-transfected lysate.)

Immunofluorescence (IF)

(Immunofluorescence of purified antibody to KBTBD9 on HeLa cell. [antibody concentration 10ug/ml].)

Product Categories/Family for anti-KLHL29 antibody

Antibodies; Abs to Kelch-like Proteins

NCBI and Uniprot Product Information

• NCBI GI #: 256818754
• NCBI GeneID: 114818
• NCBI Accession #: NP_443152.1
• NCBI GenBank Nucleotide #: NM_052920.1
• UniProt Accession #: Q96CT2; Q8N388; Q96BF0; Q96PW7
• Molecular Weight: 71,468 Da
• NCBI Official Full Name: kelch-like protein 29
• NCBI Official Synonym Full Names: kelch-like family member 29
• NCBI Official Symbol: KLHL29
• NCBI Official Synonym Symbols: KBTBD9
• NCBI Protein Information: kelch-like protein 29; kelch-like 29; kelch repeat and BTB (POZ) domain containing 9; kelch repeat and BTB domain-containing protein 9
• UniProt Protein Name: Kelch-like protein 29
• Protein Family: Kelch-like protein
• UniProt Gene Name: KLHL29
• UniProt Synonym Gene Names: KBTBD9; KIAA1921
• UniProt Entry Name: KLH29_HUMAN

Uniprot Description

KLHL29: 2 isoforms of the human protein are produced by alternative splicing

Chromosomal Location of Human Ortholog: 2p24.1