Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (Western Blot analysis of KBTBD9 expression in transfected 293T cell line by KBTBD9 polyclonal antibody. Lane 1: KBTBD9 transfected lysate (55.33kD). Lane 2: Non-transfected lysate.)

Mouse anti-Human KBTBD9 Polyclonal Antibody | anti-KLHL29 antibody

KBTBD9 (Kelch-like Protein 29, Kelch Repeat and BTB Domain-containing Protein 9, KLHL29, KBTBD9, KIAA1921)

Gene Names
KLHL29; KBTBD9
Reactivity
Human
Applications
Western Blot, Immunofluorescence
Purity
Affinity Purified
Purified by Protein A affinity chromatography.
Synonyms
KBTBD9; Polyclonal Antibody; KBTBD9 (Kelch-like Protein 29; Kelch Repeat and BTB Domain-containing Protein 9; KLHL29; KIAA1921); Anti -KBTBD9 (Kelch-like Protein 29; anti-KLHL29 antibody
Ordering
For Research Use Only!
Host
Mouse
Reactivity
Human
Clonality
Polyclonal
Isotype
IgG
Specificity
Recognizes human KBTBD9.
Purity/Purification
Affinity Purified
Purified by Protein A affinity chromatography.
Form/Format
Supplied as a liquid in PBS, pH 7.2.
Sequence
MPGHYSLPQPPSQPLSSVVVNMPAQALYASPQPLAVSTLPGVGQVARPGPTAVGNGHMAGPLLPPPPPAQPSATLPSGAPATNGPPTTDSAHGLQMLRTIGVGKYEFTDPGHPREMLKELNQQRRAKAFTDLKIVVEGREFEVHQNVLASCSLYFKDLIQRSVQDSGQGGREKLELVLSNLQADVLELLLEFVYTGSLVIDSANAKTLLEAASKFQFHTFCKVCVSFLEKQLTASNCLGVLAMAEAMQCSELYHMAKAFALQIFPEVAAQEEILSISKDDFIAYVSNDSLNTKAEELVYETVIKWIKKDPATRTQYAAELLAVVRLPFIHPSYLLNVVDNEELIKSSEACRDLVNEAKRYHMLPHARQEMQTPRTRPRLSAGVAEVIVLVGGRQMVGMTQRSLVAVTCWNPQNNKWYPLASLPFYDREFFSVVSAGDNIYLSGGMESGVTLADVWCYMSLLDNWNLVSRMTVPRCRHNSLVYDGKIYTLGGLGVAGNVDHVER
Applicable Applications for anti-KLHL29 antibody
Western Blot (WB), Immunofluorescence (IF)
Application Notes
Suitable for use in Immunofluorescence and Western Blot.
Dilution: Immunofluorescence: 10ug/ml
Immunogen
Full length human KBTBD9, aa1-503 (AAH15667).
Preparation and Storage
May be stored at 4 degree C for short-term only. Aliquot to avoid repeated freezing and thawing. Store at -20 degree C. Aliquots are stable for at least 12 months. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.

Western Blot (WB)

(Western Blot analysis of KBTBD9 expression in transfected 293T cell line by KBTBD9 polyclonal antibody. Lane 1: KBTBD9 transfected lysate (55.33kD). Lane 2: Non-transfected lysate.)

Western Blot (WB) (Western Blot analysis of KBTBD9 expression in transfected 293T cell line by KBTBD9 polyclonal antibody. Lane 1: KBTBD9 transfected lysate (55.33kD). Lane 2: Non-transfected lysate.)

Immunofluorescence (IF)

(Immunofluorescence of purified antibody to KBTBD9 on HeLa cell. [antibody concentration 10ug/ml].)

Immunofluorescence (IF) (Immunofluorescence of purified antibody to KBTBD9 on HeLa cell. [antibody concentration 10ug/ml].)
Product Categories/Family for anti-KLHL29 antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
71,468 Da
NCBI Official Full Name
kelch-like protein 29
NCBI Official Synonym Full Names
kelch-like family member 29
NCBI Official Symbol
KLHL29
NCBI Official Synonym Symbols
KBTBD9
NCBI Protein Information
kelch-like protein 29; kelch-like 29; kelch repeat and BTB (POZ) domain containing 9; kelch repeat and BTB domain-containing protein 9
UniProt Protein Name
Kelch-like protein 29
Protein Family
UniProt Gene Name
KLHL29
UniProt Synonym Gene Names
KBTBD9; KIAA1921
UniProt Entry Name
KLH29_HUMAN

Uniprot Description

KLHL29: 2 isoforms of the human protein are produced by alternative splicing

Chromosomal Location of Human Ortholog: 2p24.1

Research Articles on KLHL29

Similar Products

Product Notes

The KLHL29 klhl29 (Catalog #AAA6003218) is an Antibody produced from Mouse and is intended for research purposes only. The product is available for immediate purchase. The KBTBD9 (Kelch-like Protein 29, Kelch Repeat and BTB Domain-containing Protein 9, KLHL29, KBTBD9, KIAA1921) reacts with Human and may cross-react with other species as described in the data sheet. AAA Biotech's KBTBD9 can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB), Immunofluorescence (IF). Suitable for use in Immunofluorescence and Western Blot. Dilution: Immunofluorescence: 10ug/ml. Researchers should empirically determine the suitability of the KLHL29 klhl29 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: MPGHYSLPQP PSQPLSSVVV NMPAQALYAS PQPLAVSTLP GVGQVARPGP TAVGNGHMAG PLLPPPPPAQ PSATLPSGAP ATNGPPTTDS AHGLQMLRTI GVGKYEFTDP GHPREMLKEL NQQRRAKAFT DLKIVVEGRE FEVHQNVLAS CSLYFKDLIQ RSVQDSGQGG REKLELVLSN LQADVLELLL EFVYTGSLVI DSANAKTLLE AASKFQFHTF CKVCVSFLEK QLTASNCLGV LAMAEAMQCS ELYHMAKAFA LQIFPEVAAQ EEILSISKDD FIAYVSNDSL NTKAEELVYE TVIKWIKKDP ATRTQYAAEL LAVVRLPFIH PSYLLNVVDN EELIKSSEAC RDLVNEAKRY HMLPHARQEM QTPRTRPRLS AGVAEVIVLV GGRQMVGMTQ RSLVAVTCWN PQNNKWYPLA SLPFYDREFF SVVSAGDNIY LSGGMESGVT LADVWCYMSL LDNWNLVSRM TVPRCRHNSL VYDGKIYTLG GLGVAGNVDH VER. It is sometimes possible for the material contained within the vial of "KBTBD9, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.