Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (Host: RabbitTarget Name: MSRASample Type: HT1080 Whole Cell lysatesAntibody Dilution: 1.0ug/mlMSRA is supported by BioGPS gene expression data to be expressed in HT1080)

Rabbit MSRA Polyclonal Antibody | anti-MSRA antibody

MSRA Antibody - middle region

Gene Names
MSRA; PMSR
Reactivity
Cow, Dog, Guinea Pig, Horse, Human, Mouse, Pig, Rabbit, Rat
Applications
Western Blot
Purity
Affinity Purified
Synonyms
MSRA; Polyclonal Antibody; MSRA Antibody - middle region; anti-MSRA antibody
Ordering
For Research Use Only!
Host
Rabbit
Reactivity
Cow, Dog, Guinea Pig, Horse, Human, Mouse, Pig, Rabbit, Rat
Clonality
Polyclonal
Purity/Purification
Affinity Purified
Form/Format
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence
Synthetic peptide located within the following region: VYSTQVGFAGGYTSNPTYKEVCSEKTGHAEVVRVVYQPEHMSFEELLKVF
Sequence Length
192
Applicable Applications for anti-MSRA antibody
Western Blot (WB)
Homology
Cow: 86%; Dog: 86%; Guinea Pig: 86%; Horse: 100%; Human: 100%; Mouse: 100%; Pig: 93%; Rabbit: 93%; Rat: 100%
Immunogen
The immunogen is a synthetic peptide directed towards the middle region of Human MSRA
Preparation and Storage
For short term use, store at 2-8 degree C up to 1 week. For long term storage, store at -20 degree C in small aliquots to prevent freeze-thaw cycles.

Western Blot (WB)

(Host: RabbitTarget Name: MSRASample Type: HT1080 Whole Cell lysatesAntibody Dilution: 1.0ug/mlMSRA is supported by BioGPS gene expression data to be expressed in HT1080)

Western Blot (WB) (Host: RabbitTarget Name: MSRASample Type: HT1080 Whole Cell lysatesAntibody Dilution: 1.0ug/mlMSRA is supported by BioGPS gene expression data to be expressed in HT1080)
Related Product Information for anti-MSRA antibody
This is a rabbit polyclonal antibody against MSRA. It was validated on Western Blot

Target Description: This protein is ubiquitous and highly conserved. It carries out the enzymatic reduction of methionine sulfoxide to methionine. Human and animal studies have shown the highest levels of expression in kidney and nervous tissue. Its proposed function is the repair of oxidative damage to proteins to restore biological activity. Three transcript variants encoding different isoforms have been found for this gene.
Product Categories/Family for anti-MSRA antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
21kDa
NCBI Official Full Name
mitochondrial peptide methionine sulfoxide reductase isoform b
NCBI Official Synonym Full Names
methionine sulfoxide reductase A
NCBI Official Symbol
MSRA
NCBI Official Synonym Symbols
PMSR
NCBI Protein Information
mitochondrial peptide methionine sulfoxide reductase
UniProt Protein Name
Mitochondrial peptide methionine sulfoxide reductase
UniProt Gene Name
MSRA
UniProt Synonym Gene Names
Peptide Met(O) reductase; PMSR
UniProt Entry Name
MSRA_HUMAN

NCBI Description

This gene encodes a ubiquitous and highly conserved protein that carries out the enzymatic reduction of methionine sulfoxide to methionine. Human and animal studies have shown the highest levels of expression in kidney and nervous tissue. The protein functions in the repair of oxidatively damaged proteins to restore biological activity. Alternative splicing results in multiple transcript variants. [provided by RefSeq, May 2014]

Uniprot Description

MSRA: Has an important function as a repair enzyme for proteins that have been inactivated by oxidation. Catalyzes the reversible oxidation-reduction of methionine sulfoxide in proteins to methionine. Belongs to the MsrA Met sulfoxide reductase family. 5 isoforms of the human protein are produced by alternative promoter.

Protein type: EC 1.8.4.11; Oxidoreductase

Chromosomal Location of Human Ortholog: 8p23.1

Cellular Component: nucleoplasm; mitochondrion; membrane; cytoplasm; actin cytoskeleton

Molecular Function: peptide-methionine-(S)-S-oxide reductase activity

Biological Process: protein repair; protein modification process; methionine metabolic process; response to oxidative stress

Research Articles on MSRA

Similar Products

Product Notes

The MSRA msra (Catalog #AAA3212960) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The MSRA Antibody - middle region reacts with Cow, Dog, Guinea Pig, Horse, Human, Mouse, Pig, Rabbit, Rat and may cross-react with other species as described in the data sheet. AAA Biotech's MSRA can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). Researchers should empirically determine the suitability of the MSRA msra for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: Synthetic peptide located within the following region: VYSTQVGFAG GYTSNPTYKE VCSEKTGHAE VVRVVYQPEH MSFEELLKVF. It is sometimes possible for the material contained within the vial of "MSRA, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.