Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (MSRA rabbit polyclonal antibody. Western Blot analysis of MSRA expression in mouse kidney.)

Rabbit anti-Human, Mouse MSRA Polyclonal Antibody | anti-MSRA antibody

MSRA (Methionine Sulfoxide Reductase A, Peptide Methionine Sulfoxide Reductase, Peptide-methionine (S)-S-oxide Reductase, Peptide Met(O) Reductase, Protein-methionine-S-oxide Reductase, PMSR) (PE)

Gene Names
MSRA; PMSR
Reactivity
Human, Mouse
Applications
Western Blot
Purity
Purified by Protein A Affinity Chromatography.
Synonyms
MSRA; Polyclonal Antibody; MSRA (Methionine Sulfoxide Reductase A; Peptide Methionine Sulfoxide Reductase; Peptide-methionine (S)-S-oxide Reductase; Peptide Met(O) Reductase; Protein-methionine-S-oxide Reductase; PMSR) (PE); anti-MSRA antibody
Ordering
For Research Use Only!
Host
Rabbit
Reactivity
Human, Mouse
Clonality
Polyclonal
Isotype
IgG
Specificity
Recognizes human MSRA. Species Crossreactivity: mouse.
Purity/Purification
Purified by Protein A Affinity Chromatography.
Form/Format
Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with R-Phycoerythrin (PE).
Applicable Applications for anti-MSRA antibody
Western Blot (WB)
Application Notes
Applications are based on unconjugated antibody.
Immunogen
Full length human MSRA, aa1-235 (NP_036463.1).
Immunogen Sequence
MLSATRRACQLLLLHSLFPVPRMGNSASNIVSPQEALPGRKEQTPVAAKHHVNGNRTVEPFPEGTQMAVFGMGCFWGAERKFWVLKGVYSTQVGFAGGYTSNPTYKEVCSEKTGHAEVVRVVYQPEHMSFEELLKVFWENHDPTQGMRQGNDHGTQYRSAIYPTSAKQMEAALSSKENYQKVLSEHGFGPITTDIREGQTFYYAEDYHQQYLSKNPNGYCGLGGTGVSCPVGIKK
Conjugate
PE
Note
Preservative Free
Preparation and Storage
Store product at 4 degree C in the dark. DO NOT FREEZE! Stable at 4 degree C for 12 months after receipt as an undiluted liquid. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. Caution: PE conjugates are sensitive to light. For maximum recovery of product, centrifuge the original vial prior to removing the cap.

Western Blot (WB)

(MSRA rabbit polyclonal antibody. Western Blot analysis of MSRA expression in mouse kidney.)

Western Blot (WB) (MSRA rabbit polyclonal antibody. Western Blot analysis of MSRA expression in mouse kidney.)

Western Blot (WB)

(Western Blot analysis of MSRA expression in transfected 293T cell line by MSRA polyclonal antibody. Lane 1: MSRA transfected lysate (26.1kD). Lane 2: Non-transfected lysate.)

Western Blot (WB) (Western Blot analysis of MSRA expression in transfected 293T cell line by MSRA polyclonal antibody. Lane 1: MSRA transfected lysate (26.1kD). Lane 2: Non-transfected lysate.)
Related Product Information for anti-MSRA antibody
MSRA is ubiquitous and highly conserved. This protein carries out the enzymatic reduction of methionine sulfoxide to methionine. Human and animal studies have shown the highest levels of expression in kidney and nervous tissue. The protein's proposed function is the repair of oxidative damage to proteins to restore biological activity.
Product Categories/Family for anti-MSRA antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
NCBI Official Full Name
mitochondrial peptide methionine sulfoxide reductase isoform a
NCBI Official Synonym Full Names
methionine sulfoxide reductase A
NCBI Official Symbol
MSRA
NCBI Official Synonym Symbols
PMSR
NCBI Protein Information
mitochondrial peptide methionine sulfoxide reductase
UniProt Protein Name
Mitochondrial peptide methionine sulfoxide reductase
UniProt Gene Name
MSRA
UniProt Synonym Gene Names
Peptide Met(O) reductase; PMSR
UniProt Entry Name
MSRA_HUMAN

NCBI Description

This gene encodes a ubiquitous and highly conserved protein that carries out the enzymatic reduction of methionine sulfoxide to methionine. Human and animal studies have shown the highest levels of expression in kidney and nervous tissue. The protein functions in the repair of oxidatively damaged proteins to restore biological activity. Alternative splicing results in multiple transcript variants. [provided by RefSeq, May 2014]

Uniprot Description

MSRA: Has an important function as a repair enzyme for proteins that have been inactivated by oxidation. Catalyzes the reversible oxidation-reduction of methionine sulfoxide in proteins to methionine. Belongs to the MsrA Met sulfoxide reductase family. 5 isoforms of the human protein are produced by alternative promoter.

Protein type: EC 1.8.4.11; Oxidoreductase

Chromosomal Location of Human Ortholog: 8p23.1

Cellular Component: nucleoplasm; mitochondrion; membrane; cytoplasm; actin cytoskeleton

Molecular Function: peptide-methionine-(S)-S-oxide reductase activity

Biological Process: protein repair; protein modification process; methionine metabolic process; response to oxidative stress

Research Articles on MSRA

Similar Products

Product Notes

The MSRA msra (Catalog #AAA6386027) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The MSRA (Methionine Sulfoxide Reductase A, Peptide Methionine Sulfoxide Reductase, Peptide-methionine (S)-S-oxide Reductase, Peptide Met(O) Reductase, Protein-methionine-S-oxide Reductase, PMSR) (PE) reacts with Human, Mouse and may cross-react with other species as described in the data sheet. AAA Biotech's MSRA can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). Applications are based on unconjugated antibody. Researchers should empirically determine the suitability of the MSRA msra for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. It is sometimes possible for the material contained within the vial of "MSRA, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.