Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (WB Suggested Anti-Msc Antibody Titration: 0.2-1 ug/mlPositive Control: Mouse Small Instestine)

Rabbit Msc Polyclonal Antibody | anti-MSC antibody

Msc antibody - C-terminal region

Gene Names
Msc; MyoR; bHLHa22
Reactivity
Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat
Applications
Western Blot
Purity
Affinity Purified
Synonyms
Msc; Polyclonal Antibody; Msc antibody - C-terminal region; anti-MSC antibody
Ordering
For Research Use Only!
Host
Rabbit
Reactivity
Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat
Clonality
Polyclonal
Purity/Purification
Affinity Purified
Form/Format
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence
Synthetic peptide located within the following region: IAHLRQLLQEDRYEDSYVHPVNLTWPFVVSGRPDSDSKDVSAANRLCGTS
Sequence Length
201
Applicable Applications for anti-MSC antibody
Western Blot (WB)
Homology
Cow: 86%; Dog: 86%; Guinea Pig: 93%; Horse: 86%; Human: 86%; Mouse: 100%; Rabbit: 79%; Rat: 93%
Immunogen
The immunogen is a synthetic peptide directed towards the C terminal region of mouse Msc
Preparation and Storage
For short term use, store at 2-8 degree C up to 1 week. For long term storage, store at -20 degree C in small aliquots to prevent freeze-thaw cycles.

Western Blot (WB)

(WB Suggested Anti-Msc Antibody Titration: 0.2-1 ug/mlPositive Control: Mouse Small Instestine)

Western Blot (WB) (WB Suggested Anti-Msc Antibody Titration: 0.2-1 ug/mlPositive Control: Mouse Small Instestine)
Related Product Information for anti-MSC antibody
This is a rabbit polyclonal antibody against Msc. It was validated on Western Blot

Target Description: Msc is a transcription repressor that blocks myogenesis and activation of E-box dependent muscle genes.
Product Categories/Family for anti-MSC antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
21kDa
NCBI Official Full Name
musculin isoform 1
NCBI Official Synonym Full Names
musculin
NCBI Official Symbol
Msc
NCBI Official Synonym Symbols
MyoR; bHLHa22
NCBI Protein Information
musculin
UniProt Protein Name
Musculin
Protein Family
UniProt Gene Name
Msc
UniProt Synonym Gene Names
Myor
UniProt Entry Name
MUSC_MOUSE

Research Articles on MSC

Similar Products

Product Notes

The MSC msc (Catalog #AAA3203455) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The Msc antibody - C-terminal region reacts with Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat and may cross-react with other species as described in the data sheet. AAA Biotech's Msc can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). Researchers should empirically determine the suitability of the MSC msc for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: Synthetic peptide located within the following region: IAHLRQLLQE DRYEDSYVHP VNLTWPFVVS GRPDSDSKDV SAANRLCGTS. It is sometimes possible for the material contained within the vial of "Msc, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.