Western Blot (WB)
(MPPED1 polyclonal antibody. Western Blot analysis of MPPED1 expression in rat brain.)
Mouse anti-Human, Rat MPPED1 Polyclonal Antibody | anti-Mpped1 antibody
MPPED1 (Metallophosphoesterase Domain-containing Protein 1, Adult Brain Protein 239, 239AB, C22orf1, FAM1A)
Gene Names
Mpped1; AW456965; 6230403M19; D15Bwg0669e
Reactivity
Human, Rat
Applications
Western Blot, Immunohistochemistry
Purity
Affinity PurifiedPurified by Protein A affinity chromatography.
Synonyms
MPPED1; Polyclonal Antibody; MPPED1 (Metallophosphoesterase Domain-containing Protein 1; Adult Brain Protein 239; 239AB; C22orf1; FAM1A); Anti -MPPED1 (Metallophosphoesterase Domain-containing Protein 1; anti-Mpped1 antibody
Host
Mouse
Reactivity
Human, Rat
Clonality
Polyclonal
Isotype
IgG
Specificity
Recognizes human MPPED1. Species Crossreactivity: rat.
Purity/Purification
Affinity Purified
Purified by Protein A affinity chromatography.
Purified by Protein A affinity chromatography.
Form/Format
Supplied as a liquid in PBS, pH 7.2.
Sequence
MWRSRWDASVLKAEALALLPCGLGMAFSQSHVMAARRHQHSRLIIEVDEYSSNPTQAFTFYNINQGRFQPPHVQMVDPVPHDAPKPPGYTRFVCVSDTHSRTDPIQMPYGDVLIHAGDFTELGLPSEVKKFNEWLGSLPYEYKIVIAGNHELTFDQEFMADLIKQDFYYFPSVSKLKPENYENVQSLLTNCIYLQDSEVTVRGFRIYGSPWQPWFYGWGFNLPRGQALLEKWNLIPEGVDILITHGPPLGFLDWVPKKMQRVGCVELLNTVQRRVQPRLHVFGHIHEGYGVMADGTTTYVNASVCTVNYQPVNPPIVIDLPTPRNS
Applicable Applications for anti-Mpped1 antibody
Western Blot (WB), Immunohistochemistry (IHC)
Application Notes
Suitable for use in Western Blot and Immunohistochemistry.
Dilution: Immunohistochemistry (Formalin fixed paraffin embedded): 3ug/ml
Dilution: Immunohistochemistry (Formalin fixed paraffin embedded): 3ug/ml
Immunogen
Full length human MPPED1, aa1-326 (NP_001576.3).
Preparation and Storage
May be stored at 4 degree C for short-term only. Aliquot to avoid repeated freezing and thawing. Store at -20 degree C. Aliquots are stable for at least 12 months. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.
Western Blot (WB)
(MPPED1 polyclonal antibody. Western Blot analysis of MPPED1 expression in rat brain.)
Western Blot (WB)
(MPPED1 polyclonal antibody. Western Blot analysis of MPPED1 expression in rat brain.)
Western Blot (WB)
(Western Blot analysis of MPPED1 expression in transfected 293T cell line by MPPED1 polyclonal antibody. Lane 1: MPPED1 transfected lysate (35.86kD). Lane 2: Non-transfected lysate.)
Western Blot (WB)
(Western Blot analysis of MPPED1 expression in transfected 293T cell line by MPPED1 polyclonal antibody. Lane 1: MPPED1 transfected lysate (35.86kD). Lane 2: Non-transfected lysate.)
Immunohistochemistry (IHC)
(Immunoperoxidase of purified antibody to MPPED1 on formalin-fixed paraffin-embedded human stomach. [antibody concentration 3ug/ml].)
Immunohistochemistry (IHC)
(Immunoperoxidase of purified antibody to MPPED1 on formalin-fixed paraffin-embedded human stomach. [antibody concentration 3ug/ml].)
Related Product Information for anti-Mpped1 antibody
May have metallophosphoesterase activity (in vitro).
Product Categories/Family for anti-Mpped1 antibody
NCBI and Uniprot Product Information
NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
Molecular Weight
37,214 Da
NCBI Official Full Name
metallophosphoesterase domain-containing protein 1
NCBI Official Synonym Full Names
metallophosphoesterase domain containing 1
NCBI Official Symbol
Mpped1
NCBI Official Synonym Symbols
AW456965; 6230403M19; D15Bwg0669e
NCBI Protein Information
metallophosphoesterase domain-containing protein 1
UniProt Protein Name
Metallophosphoesterase domain-containing protein 1
Protein Family
UniProt Gene Name
Mpped1
UniProt Synonym Gene Names
D15Bwg0669e
UniProt Entry Name
MPPD1_MOUSE
Uniprot Description
MPPED1: May have metallophosphoesterase activity (in vitro). Belongs to the UPF0046 family
Molecular Function: nuclease activity; hydrolase activity; T/G mismatch-specific endonuclease activity; phosphoric ester hydrolase activity
Similar Products
Product Notes
The Mpped1 mpped1 (Catalog #AAA641424) is an Antibody produced from Mouse and is intended for research purposes only. The product is available for immediate purchase. The MPPED1 (Metallophosphoesterase Domain-containing Protein 1, Adult Brain Protein 239, 239AB, C22orf1, FAM1A) reacts with Human, Rat and may cross-react with other species as described in the data sheet. AAA Biotech's MPPED1 can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB), Immunohistochemistry (IHC). Suitable for use in Western Blot and Immunohistochemistry. Dilution: Immunohistochemistry (Formalin fixed paraffin embedded): 3ug/ml. Researchers should empirically determine the suitability of the Mpped1 mpped1 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: MWRSRWDASV LKAEALALLP CGLGMAFSQS HVMAARRHQH SRLIIEVDEY SSNPTQAFTF YNINQGRFQP PHVQMVDPVP HDAPKPPGYT RFVCVSDTHS RTDPIQMPYG DVLIHAGDFT ELGLPSEVKK FNEWLGSLPY EYKIVIAGNH ELTFDQEFMA DLIKQDFYYF PSVSKLKPEN YENVQSLLTN CIYLQDSEVT VRGFRIYGSP WQPWFYGWGF NLPRGQALLE KWNLIPEGVD ILITHGPPLG FLDWVPKKMQ RVGCVELLNT VQRRVQPRLH VFGHIHEGYG VMADGTTTYV NASVCTVNYQ PVNPPIVIDL PTPRNS. It is sometimes possible for the material contained within the vial of "MPPED1, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.Precautions
All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.Disclaimer
Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.Item has been added to Shopping Cart
If you are ready to order, navigate to Shopping Cart and get ready to checkout.
