Immunohistochemistry (IHC)
(Sample Type: Human KidneyAnti-MPDZ antibody IHC of human kidney. Immunohistochemistry of formalin-fixed, paraffin-embedded tissue after heat-induced antigen retrieval. MPDZ Antibody concentration 5 ug/ml.)
Rabbit MPDZ Polyclonal Antibody | anti-MPDZ antibody
MPDZ antibody - middle region
Gene Names
MPDZ; HYC2; MUPP1
Reactivity
Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat
Applications
Immunohistochemistry, Western Blot
Purity
Affinity Purified
Synonyms
MPDZ; Polyclonal Antibody; MPDZ antibody - middle region; anti-MPDZ antibody
Host
Rabbit
Reactivity
Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat
Clonality
Polyclonal
Purity/Purification
Affinity Purified
Form/Format
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence
Synthetic peptide located within the following region: DEAINVLRQTPQRVRLTLYRDEAPYKEEEVCDTLTIELQKKPGKGLGLSI
Sequence Length
2041
Applicable Applications for anti-MPDZ antibody
Immunohistochemistry (IHC), Western Blot (WB)
Homology
Cow: 100%; Dog: 100%; Guinea Pig: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Rabbit: 100%; Rat: 100%
Immunogen
The immunogen is a synthetic peptide directed towards the middle region of human MPDZ
Preparation and Storage
For short term use, store at 2-8 degree C up to 1 week. For long term storage, store at -20 degree C in small aliquots to prevent freeze-thaw cycles.
Immunohistochemistry (IHC)
(Sample Type: Human KidneyAnti-MPDZ antibody IHC of human kidney. Immunohistochemistry of formalin-fixed, paraffin-embedded tissue after heat-induced antigen retrieval. MPDZ Antibody concentration 5 ug/ml.)
Immunohistochemistry (IHC)
(Sample Type: Human KidneyAnti-MPDZ antibody IHC of human kidney. Immunohistochemistry of formalin-fixed, paraffin-embedded tissue after heat-induced antigen retrieval. MPDZ Antibody concentration 5 ug/ml.)
Western Blot (WB)
(Lanes:Lane 1: 30ug of HeLa cell lysateLane 2: 30ug of 293T cell lysatePrimary Antibody Dilution:1:2000Secondary Antibody:Anti-rabbit-HRPSecondary Antibody Dilution:1:5000Gene Name:MPDZSubmitted by:Jixin Dong & Yuanhong Chen,University of Nebraska)
Western Blot (WB)
(Lanes:Lane 1: 30ug of HeLa cell lysateLane 2: 30ug of 293T cell lysatePrimary Antibody Dilution:1:2000Secondary Antibody:Anti-rabbit-HRPSecondary Antibody Dilution:1:5000Gene Name:MPDZSubmitted by:Jixin Dong & Yuanhong Chen,University of Nebraska)
Western Blot (WB)
(WB Suggested Anti-MPDZ Antibody Titration: 0.2-1 ug/mlELISA Titer: 1:312500Positive Control: Human Liver)
Western Blot (WB)
(WB Suggested Anti-MPDZ Antibody Titration: 0.2-1 ug/mlELISA Titer: 1:312500Positive Control: Human Liver)
Related Product Information for anti-MPDZ antibody
This is a rabbit polyclonal antibody against MPDZ. It was validated on Western Blot using a cell lysate as a positive control.
Target Description: The exact function of MPDZ remains unknown.
Target Description: The exact function of MPDZ remains unknown.
Product Categories/Family for anti-MPDZ antibody
NCBI and Uniprot Product Information
NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
218kDa
NCBI Official Full Name
multiple PDZ domain protein isoform 1
NCBI Official Synonym Full Names
multiple PDZ domain crumbs cell polarity complex component
NCBI Official Symbol
MPDZ
NCBI Official Synonym Symbols
HYC2; MUPP1
NCBI Protein Information
multiple PDZ domain protein
UniProt Protein Name
Multiple PDZ domain protein
Protein Family
UniProt Gene Name
MPDZ
UniProt Synonym Gene Names
MUPP1
UniProt Entry Name
MPDZ_HUMAN
NCBI Description
The protein encoded by this gene has multiple PDZ domains, which are hallmarks of protein-protein interactions. The encoded protein is known to interact with the HTR2C receptor and may cause it to clump at the cell surface. Multiple transcript variants encoding different isoforms have been found for this gene. [provided by RefSeq, Aug 2015]
Research Articles on MPDZ
Similar Products
Product Notes
The MPDZ mpdz (Catalog #AAA3206601) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The MPDZ antibody - middle region reacts with Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat and may cross-react with other species as described in the data sheet. AAA Biotech's MPDZ can be used in a range of immunoassay formats including, but not limited to, Immunohistochemistry (IHC), Western Blot (WB). Researchers should empirically determine the suitability of the MPDZ mpdz for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: Synthetic peptide located within the following region: DEAINVLRQT PQRVRLTLYR DEAPYKEEEV CDTLTIELQK KPGKGLGLSI. It is sometimes possible for the material contained within the vial of "MPDZ, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.Precautions
All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.Disclaimer
Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.Item has been added to Shopping Cart
If you are ready to order, navigate to Shopping Cart and get ready to checkout.
