Western Blot (WB)
(WB Suggested Anti-MGC20983 Antibody Titration: 0.2-1 ug/mlELISA Titer: 1:12500Positive Control: 293T cell lysate)
Rabbit anti-Human MGC20983 Polyclonal Antibody | anti-CCDC151 antibody
MGC20983 antibody - middle region
Gene Names
CCDC151; CILD30
Reactivity
Human
Applications
Western Blot
Purity
Affinity Purified
Synonyms
MGC20983; Polyclonal Antibody; MGC20983 antibody - middle region; anti-CCDC151 antibody
Host
Rabbit
Reactivity
Human
Clonality
Polyclonal
Purity/Purification
Affinity Purified
Form/Format
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence
Synthetic peptide located within the following region: IALPLATSKDKFFDEESEEEDNEVVTRASLKIRSQKLIESHKKHRRSRRS
Sequence Length
595
Applicable Applications for anti-CCDC151 antibody
Western Blot (WB)
Homology
Human: 100%
Immunogen
The immunogen is a synthetic peptide directed towards the middle region of human MGC20983
Preparation and Storage
For short term use, store at 2-8 degree C up to 1 week. For long term storage, store at -20 degree C in small aliquots to prevent freeze-thaw cycles.
Western Blot (WB)
(WB Suggested Anti-MGC20983 Antibody Titration: 0.2-1 ug/mlELISA Titer: 1:12500Positive Control: 293T cell lysate)
Western Blot (WB)
(WB Suggested Anti-MGC20983 Antibody Titration: 0.2-1 ug/mlELISA Titer: 1:12500Positive Control: 293T cell lysate)
Related Product Information for anti-CCDC151 antibody
This is a rabbit polyclonal antibody against MGC20983. It was validated on Western Blot using a cell lysate as a positive control.
Target Description: The function of the MGC20983 protein remains unknown.
Target Description: The function of the MGC20983 protein remains unknown.
Product Categories/Family for anti-CCDC151 antibody
NCBI and Uniprot Product Information
NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
69kDa
NCBI Official Full Name
coiled-coil domain-containing protein 151 isoform 1
NCBI Official Synonym Full Names
coiled-coil domain containing 151
NCBI Official Symbol
CCDC151
NCBI Official Synonym Symbols
CILD30
NCBI Protein Information
coiled-coil domain-containing protein 151
UniProt Protein Name
Coiled-coil domain-containing protein 151
Protein Family
UniProt Gene Name
CCDC151
UniProt Entry Name
CC151_HUMAN
NCBI Description
This gene encodes a protein containing coiled-coil domains. The encoded protein functions in outer dynein arm assembly and is required for motile cilia function. Mutations in this gene result in primary ciliary dyskinesia. Alternative splicing results in multiple transcript variants encoding different isoforms. [provided by RefSeq, Oct 2014]
Research Articles on CCDC151
Similar Products
Product Notes
The CCDC151 ccdc151 (Catalog #AAA3210976) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The MGC20983 antibody - middle region reacts with Human and may cross-react with other species as described in the data sheet. AAA Biotech's MGC20983 can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). Researchers should empirically determine the suitability of the CCDC151 ccdc151 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: Synthetic peptide located within the following region: IALPLATSKD KFFDEESEEE DNEVVTRASL KIRSQKLIES HKKHRRSRRS. It is sometimes possible for the material contained within the vial of "MGC20983, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.Precautions
All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.Disclaimer
Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.Item has been added to Shopping Cart
If you are ready to order, navigate to Shopping Cart and get ready to checkout.
