Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (WB Suggested Anti-MOS Antibody Titration: 0.2-1 ug/mlELISA Titer: 1:12500Positive Control: NCI-H226 cell lysateMOS is supported by BioGPS gene expression data to be expressed in NCIH226)

Rabbit MOS Polyclonal Antibody | anti-MOS antibody

MOS antibody - middle region

Gene Names
MOS; MSV
Reactivity
Cow, Dog, Guinea Pig, Human, Mouse, Pig, Rabbit, Rat
Applications
Western Blot
Purity
Affinity Purified
Synonyms
MOS; Polyclonal Antibody; MOS antibody - middle region; anti-MOS antibody
Ordering
For Research Use Only!
Host
Rabbit
Reactivity
Cow, Dog, Guinea Pig, Human, Mouse, Pig, Rabbit, Rat
Clonality
Polyclonal
Purity/Purification
Affinity Purified
Form/Format
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence
Synthetic peptide located within the following region: LNVARLRHDNIVRVVAASTRTPAGSNSLGTIIMEFGGNVTLHQVIYGAAG
Sequence Length
346
Applicable Applications for anti-MOS antibody
Western Blot (WB)
Homology
Cow: 92%; Dog: 100%; Guinea Pig: 86%; Human: 100%; Mouse: 100%; Pig: 100%; Rabbit: 93%; Rat: 100%
Immunogen
The immunogen is a synthetic peptide directed towards the middle region of human MOS
Preparation and Storage
For short term use, store at 2-8 degree C up to 1 week. For long term storage, store at -20 degree C in small aliquots to prevent freeze-thaw cycles.

Western Blot (WB)

(WB Suggested Anti-MOS Antibody Titration: 0.2-1 ug/mlELISA Titer: 1:12500Positive Control: NCI-H226 cell lysateMOS is supported by BioGPS gene expression data to be expressed in NCIH226)

Western Blot (WB) (WB Suggested Anti-MOS Antibody Titration: 0.2-1 ug/mlELISA Titer: 1:12500Positive Control: NCI-H226 cell lysateMOS is supported by BioGPS gene expression data to be expressed in NCIH226)
Related Product Information for anti-MOS antibody
This is a rabbit polyclonal antibody against MOS. It was validated on Western Blot using a cell lysate as a positive control.

Target Description: MOS is a serine/threonine kinase that activates the MAP kinase cascade through direct phosphorylation of the MAP kinase activator MEK (MAP2K1; MIM 176872) (Prasad et al., 2008 [PubMed 18246541]).
Product Categories/Family for anti-MOS antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
38kDa
NCBI Official Full Name
proto-oncogene serine/threonine-protein kinase mos
NCBI Official Synonym Full Names
MOS proto-oncogene, serine/threonine kinase
NCBI Official Symbol
MOS
NCBI Official Synonym Symbols
MSV
NCBI Protein Information
proto-oncogene serine/threonine-protein kinase mos
UniProt Protein Name
Proto-oncogene serine/threonine-protein kinase mos
UniProt Gene Name
MOS
UniProt Entry Name
MOS_HUMAN

NCBI Description

MOS is a serine/threonine kinase that activates the MAP kinase cascade through direct phosphorylation of the MAP kinase activator MEK (MAP2K1; MIM 176872) (Prasad et al., 2008 [PubMed 18246541]).[supplied by OMIM, Jul 2009]

Uniprot Description

MOS: a proto-oncogenic serine/threonine kinase of the MOS family. Expressed predominantly in germ cells. Crucial for normal oocyte meiosis and female fertility in mice.

Protein type: Protein kinase, Other; Kinase, protein; EC 2.7.11.1; Oncoprotein; Protein kinase, Ser/Thr (non-receptor); Other group; MOS family

Chromosomal Location of Human Ortholog: 8q11

Cellular Component: cytoplasm

Molecular Function: protein serine/threonine kinase activity; MAP kinase kinase kinase activity; ATP binding

Biological Process: establishment of meiotic spindle orientation; establishment and/or maintenance of chromatin architecture; activation of MAPKK activity; activation of MAPK activity; protein amino acid autophosphorylation; regulation of meiosis; MAPKKK cascade; meiotic spindle organization and biogenesis

Research Articles on MOS

Similar Products

Product Notes

The MOS mos (Catalog #AAA3212889) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The MOS antibody - middle region reacts with Cow, Dog, Guinea Pig, Human, Mouse, Pig, Rabbit, Rat and may cross-react with other species as described in the data sheet. AAA Biotech's MOS can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). Researchers should empirically determine the suitability of the MOS mos for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: Synthetic peptide located within the following region: LNVARLRHDN IVRVVAASTR TPAGSNSLGT IIMEFGGNVT LHQVIYGAAG. It is sometimes possible for the material contained within the vial of "MOS, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.