Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (WB Suggested Anti-CNPY3 Antibody Titration: 0.2-1 ug/mlELISA Titer: 1:12500Positive Control: ACHN cell lysateCNPY3 is supported by BioGPS gene expression data to be expressed in ACHN)

Rabbit CNPY3 Polyclonal Antibody | anti-CNPY3 antibody

CNPY3 antibody - N-terminal region

Gene Names
CNPY3; CAG4A; ERDA5; TNRC5; EIEE60; PRAT4A
Reactivity
Dog, Guinea Pig, Human, Mouse, Rat
Applications
Western Blot
Purity
Affinity Purified
Synonyms
CNPY3; Polyclonal Antibody; CNPY3 antibody - N-terminal region; anti-CNPY3 antibody
Ordering
For Research Use Only!
Host
Rabbit
Reactivity
Dog, Guinea Pig, Human, Mouse, Rat
Clonality
Polyclonal
Purity/Purification
Affinity Purified
Form/Format
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence
Synthetic peptide located within the following region: MDSMPEPASRCLLLLPLLLLLLLLLPAPELGPSQAGAEENDWVRLPSKCE
Sequence Length
278
Applicable Applications for anti-CNPY3 antibody
Western Blot (WB)
Homology
Dog: 92%; Guinea Pig: 85%; Human: 100%; Mouse: 85%; Rat: 92%
Immunogen
The immunogen is a synthetic peptide directed towards the N terminal region of human CNPY3
Preparation and Storage
For short term use, store at 2-8 degree C up to 1 week. For long term storage, store at -20 degree C in small aliquots to prevent freeze-thaw cycles.

Western Blot (WB)

(WB Suggested Anti-CNPY3 Antibody Titration: 0.2-1 ug/mlELISA Titer: 1:12500Positive Control: ACHN cell lysateCNPY3 is supported by BioGPS gene expression data to be expressed in ACHN)

Western Blot (WB) (WB Suggested Anti-CNPY3 Antibody Titration: 0.2-1 ug/mlELISA Titer: 1:12500Positive Control: ACHN cell lysateCNPY3 is supported by BioGPS gene expression data to be expressed in ACHN)
Related Product Information for anti-CNPY3 antibody
This is a rabbit polyclonal antibody against CNPY3. It was validated on Western Blot using a cell lysate as a positive control.

Target Description: PRAT4A is associated with the immature form of TLR4 (MIM 603030) and regulates its cell surface expression (Wakabayashi et al., 2006 [PubMed 16849487]).

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
31
NCBI Official Full Name
protein canopy homolog 3 isoform 1
NCBI Official Synonym Full Names
canopy FGF signaling regulator 3
NCBI Official Symbol
CNPY3
NCBI Official Synonym Symbols
CAG4A; ERDA5; TNRC5; EIEE60; PRAT4A
NCBI Protein Information
protein canopy homolog 3
UniProt Protein Name
Protein canopy homolog 3
Protein Family
UniProt Gene Name
CNPY3
UniProt Synonym Gene Names
CTG4A; ERDA5; PRAT4A; TNRC5
UniProt Entry Name
CNPY3_HUMAN

NCBI Description

This gene encodes a protein that binds members of the toll-like receptor protein family and functions as a chaperone to aid in folding and export of these proteins. Alternative splicing results in multiple transcript variants. Naturally occuring readthrough transcription occurs between this locus and the downstream GNMT (glycine N-methyltransferase) gene and is represented with GeneID:107080644. [provided by RefSeq, Jan 2016]

Uniprot Description

TNRC5: Toll-like receptor (TLR)-specific co-chaperone for HSP90B1. Required for proper TLR folding, except that of TLR3, and hence controls TLR exit from the endoplasmic reticulum. Consequently, required for both innate and adaptative immune responses. Belongs to the canopy family. 2 isoforms of the human protein are produced by alternative splicing.

Protein type: Secreted, signal peptide; Secreted

Chromosomal Location of Human Ortholog: 6p21.1

Cellular Component: endoplasmic reticulum lumen

Molecular Function: receptor binding

Biological Process: toll-like receptor signaling pathway; innate immune response

Research Articles on CNPY3

Similar Products

Product Notes

The CNPY3 cnpy3 (Catalog #AAA3213649) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The CNPY3 antibody - N-terminal region reacts with Dog, Guinea Pig, Human, Mouse, Rat and may cross-react with other species as described in the data sheet. AAA Biotech's CNPY3 can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). Researchers should empirically determine the suitability of the CNPY3 cnpy3 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: Synthetic peptide located within the following region: MDSMPEPASR CLLLLPLLLL LLLLLPAPEL GPSQAGAEEN DWVRLPSKCE. It is sometimes possible for the material contained within the vial of "CNPY3, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.