Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (Anti- MMP-9 Picoband antibody, Western blottingAll lanes: Anti MMP-9 at 0.5ug/ml Lane 1: NRK Whole Cell Lysate at 40ug Lane 2: ANA-1 Whole Cell Lysate at 40ug Lane 3: HEPA Whole Cell Lysate at 40ug Predicted bind size: 78KD Observed bind size: 78KD)

anti-Mouse, Rat MMP9 Polyclonal Antibody | anti-MMP9 antibody

Anti-MMP9 Antibody

Gene Names
Mmp9; Clg4b; Gel B; MMP-9; B/MMP9; AW743869; pro-MMP-9
Reactivity
Mouse, Rat
Applications
Western Blot, Immunohistochemistry, ELISA
Purity
Immunogen Affinity Purified
Synonyms
MMP9; Polyclonal Antibody; Anti-MMP9 Antibody; Matrix metalloproteinase-9; 82 kDa matrix metalloproteinase-9; 92 kDa gelatinase; 92 kDa type IV collagenase; CLG 4B; CLG4B; Collagenase Type 4 beta; Collagenase type IV 92 KD; EC 3.4.24.35; Gelatinase 92 KD; Gelatinase B; Gelatinase beta; GelatinaseB; GELB; Macrophage gelatinase; MANDP2; Matrix metallopeptidase 9 (gelatinase B; 92kDa gelatinase; 92kDa type IV collagenase); Matrix Metalloproteinase 9; MMP 9; MMP-9; MMP9_HUMAN; Type V collagenase; matrix metallopeptidase 9 (gelatinase B; anti-MMP9 antibody
Ordering
For Research Use Only!
Reactivity
Mouse, Rat
Clonality
Polyclonal
Purity/Purification
Immunogen Affinity Purified
Form/Format
Lyophilized. Each vial contains 5mg BSA, 0.9mg NaCl, 0.2mg Na2HPO4, 0.05mg NaN3.
Sequence Length
730
Applicable Applications for anti-MMP9 antibody
Western Blot (WB), Immunohistochemistry (IHC) Paraffin, ELISA (EIA)
Application Notes
Western Blot

Concentration : 0.1-0.5 ug/mL
Tested Species : Mouse, Rat.


Immunohistochemistry (Paraffin-embedded Section)

Concentration : 0.5-1 ug/mL
Tested Species: Mouse, Rat.
Antigen Retrieval: By Heat.


ELISA

Concentration : 0.1-0.5 ug/mL
Tested Species: Mouse





Tested Species: In-house tested species with positive results.

By Heat: Boiling the paraffin section in10 mM citrate buffer, pH 6.0 for 20 mins is required for the staining of formalin/paraffin sections.

Other applications have not been tested.

Optimal dilutions should be determined by end users.

Immunogen
A synthetic peptide corresponding to a sequence at the C-terminus of mouse MMP9 (641-672aa KALLFSKGRVWRFDLKSQKVDPQSVIRVDKEF), different from the related human sequence by thirteen amino acids, and from the related rat sequence by eight amino acids.
Ig Type
Rabbit IgG
Reconstitution
Add 0.2ml of distilled water will yield a concentration of 500ug/ml.
Preparation and Storage
At -20°C for one year. After reconstitution, at 4°C for one month. It can also be aliquoted and stored frozen at -20°C for a longer time. Avoid repeated freezing and thawing.

Western Blot (WB)

(Anti- MMP-9 Picoband antibody, Western blottingAll lanes: Anti MMP-9 at 0.5ug/ml Lane 1: NRK Whole Cell Lysate at 40ug Lane 2: ANA-1 Whole Cell Lysate at 40ug Lane 3: HEPA Whole Cell Lysate at 40ug Predicted bind size: 78KD Observed bind size: 78KD)

Western Blot (WB) (Anti- MMP-9 Picoband antibody, Western blottingAll lanes: Anti MMP-9 at 0.5ug/ml Lane 1: NRK Whole Cell Lysate at 40ug Lane 2: ANA-1 Whole Cell Lysate at 40ug Lane 3: HEPA Whole Cell Lysate at 40ug Predicted bind size: 78KD Observed bind size: 78KD)

Testing Data

(Anti- MMP-9 Picoband antibody, IHC(P)IHC(P): Mouse Kidney Tissue)

Testing Data (Anti- MMP-9 Picoband antibody, IHC(P)IHC(P): Mouse Kidney Tissue)

Immunohistochemistry (IHC)

(Anti- MMP-9 Picoband antibody, IHC(P)IHC(P): Rat Liver Tissue)

Immunohistochemistry (IHC) (Anti- MMP-9 Picoband antibody, IHC(P)IHC(P): Rat Liver Tissue)
Related Product Information for anti-MMP9 antibody
Description: Rabbit IgG polyclonal antibody for Matrix metalloproteinase-9(MMP9) detection. Tested with WB, IHC-P, ELISA in Mouse;Rat.

Background: Matrix metallopeptidase 9 (MMP-9), also known as 92 kDa type IV collagenase, 92 kDa gelatinase or gelatinase B (GELB), is an enzyme that in humans is encoded by the MMP9 gene. Proteins of the matrix metalloproteinase (MMP) family are involved in the breakdown of extracellular matrix in normal physiological processes. Most MMPs are secreted as inactive proproteins which are activated when cleaved by extracellular proteinases. The enzyme encoded by this gene degrades type IV and V collagens. Studies in rhesus monkeys suggest that the enzyme is involved in IL-8-induced mobilization of hematopoietic progenitor cells from bone marrow, and murine studies suggest a role in tumor-associated tissue remodeling.
References
1. Template:, 92kDa type IV collagenase). 2. Yuichiro Hirose et al. (May 2008). "A Functional Polymorphism in THBS2 that Affects Alternative Splicing and MMP Binding Is Associated with Lumbar-Disc Herniation".

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
80,535 Da
NCBI Official Full Name
matrix metalloproteinase-9 preproprotein
NCBI Official Synonym Full Names
matrix metallopeptidase 9
NCBI Official Symbol
Mmp9
NCBI Official Synonym Symbols
Clg4b; Gel B; MMP-9; B/MMP9; AW743869; pro-MMP-9
NCBI Protein Information
matrix metalloproteinase-9
UniProt Protein Name
Matrix metalloproteinase-9
Protein Family
UniProt Gene Name
Mmp9
UniProt Synonym Gene Names
Clg4b; MMP-9; GELB
UniProt Entry Name
MMP9_MOUSE

NCBI Description

This gene encodes a member of the matrix metalloproteinase family of extracellular matrix-degrading enzymes that are involved in tissue remodeling, wound repair, progression of atherosclerosis and tumor invasion. The encoded preproprotein undergoes proteolytic processing to generate a mature, zinc-dependent endopeptidase enzyme that degrades collagens of type IV, V and XI, and elastin. Mice lacking the encoded protein exhibit an abnormal pattern of skeletal growth plate vascularization and ossification, reduced keratinocyte hyperproliferation at all neoplastic stages, a decreased incidence of invasive tumors, and resistance to experimental autoimmune encephalomyelitis. [provided by RefSeq, Feb 2016]

Uniprot Description

MMP9: May play an essential role in local proteolysis of the extracellular matrix and in leukocyte migration. Could play a role in bone osteoclastic resorption. Cleaves KiSS1 at a Gly-|-Leu bond. Cleaves type IV and type V collagen into large C-terminal three quarter fragments and shorter N-terminal one quarter fragments. Degrades fibronectin but not laminin or Pz-peptide. Exists as monomer or homodimer; disulfide-linked. Exists also as heterodimer with a 25 kDa protein. Macrophages and transformed cell lines produce only the monomeric form. Interacts with ECM1. Activated by 4-aminophenylmercuric acetate and phorbol ester. Up-regulated by ARHGEF4, SPATA13 and APC via the JNK signaling pathway in colorectal tumor cells. Produced by normal alveolar macrophages and granulocytes. Inhibited by histatin-3 1/24 (histatin-5). Inhibited by ECM1. Belongs to the peptidase M10A family.

Protein type: Secreted; EC 3.4.24.35; Motility/polarity/chemotaxis; Secreted, signal peptide; Protease

Cellular Component: extracellular matrix; extracellular region; extracellular space; protein complex; proteinaceous extracellular matrix

Molecular Function: endopeptidase activity; fibronectin binding; hydrolase activity; identical protein binding; metal ion binding; metalloendopeptidase activity; metallopeptidase activity; peptidase activity; protein complex binding; serine-type endopeptidase activity; zinc ion binding

Biological Process: collagen catabolic process; embryo implantation; extracellular matrix organization and biogenesis; heart development; leukocyte migration; negative regulation of apoptosis; negative regulation of fibroblast proliferation; ossification; positive regulation of angiogenesis; positive regulation of apoptosis; positive regulation of DNA binding; positive regulation of epidermal growth factor receptor signaling pathway; positive regulation of keratinocyte migration; positive regulation of leukocyte migration; positive regulation of protein amino acid phosphorylation; positive regulation of synaptic plasticity; protein oligomerization; proteolysis; response to drug; response to oxidative stress; skeletal development; tissue remodeling; transformation of host cell by virus

Research Articles on MMP9

Similar Products

Product Notes

The MMP9 mmp9 (Catalog #AAA178238) is an Antibody and is intended for research purposes only. The product is available for immediate purchase. The Anti-MMP9 Antibody reacts with Mouse, Rat and may cross-react with other species as described in the data sheet. AAA Biotech's MMP9 can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB), Immunohistochemistry (IHC) Paraffin, ELISA (EIA). Western Blot Concentration : 0.1-0.5 ug/mL Tested Species : Mouse, Rat. Immunohistochemistry (Paraffin-embedded Section) Concentration : 0.5-1 ug/mL Tested Species: Mouse, Rat. Antigen Retrieval: By Heat. ELISA Concentration : 0.1-0.5 ug/mL Tested Species: Mouse Tested Species: In-house tested species with positive results. By Heat: Boiling the paraffin section in10 mM citrate buffer, pH 6.0 for 20 mins is required for the staining of formalin/paraffin sections. Other applications have not been tested. Optimal dilutions should be determined by end users. . Researchers should empirically determine the suitability of the MMP9 mmp9 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. It is sometimes possible for the material contained within the vial of "MMP9, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.