Rabbit anti-Human MMP2 Polyclonal Antibody | anti-MMP2 antibody

MMP2 Antibody - N-terminal region

Cat. Num. AAA3224201

• Gene Names: MMP2; CLG4; MONA; CLG4A; MMP-2; TBE-1; MMP-II
• Reactivity: Human
• Applications: Western Blot
• Purity: Affinity purified
• Synonyms: MMP2; Polyclonal Antibody; MMP2 Antibody - N-terminal region; anti-MMP2 antibody

• Host: Rabbit
• Reactivity: Human
• Clonality: Polyclonal
• Purity/Purification: Affinity purified
• Form/Format: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Sequence: Synthetic peptide located within the following region: MARGALTGPLRALCLLGCLLSHAAAAPSPIIKFPGDVAPKTDKELAVQYL
• Sequence Length: 660

• Applicable Applications for anti-MMP2 antibody: Western Blot (WB)
• Immunogen: The immunogen is a synthetic peptide directed towards the N terminal region of human MMP2
• Preparation and Storage: For short term use, store at 2-8 degree C up to 1 week. For long term storage, store at -20 degree C in small aliquots to prevent freeze-thaw cycles.

Western Blot (WB)

(Host: RabbitTarget Name: MMP2Sample Tissue: Human COLO205 Whole Cell lysatesAntibody Dilution: 1ug/ml)

Related Product Information for anti-MMP2 antibody

This gene is a member of the matrix metalloproteinase (MMP) gene family, that are zinc-dependent enzymes capable of cleaving components of the extracellular matrix and molecules involved in signal transduction. The protein encoded by this gene is a gelatinase A, type IV collagenase, that contains three fibronectin type II repeats in its catalytic site that allow binding of denatured type IV and V collagen and elastin. Unlike most MMP family members, activation of this protein can occur on the cell membrane. This enzyme can be activated extracellularly by proteases, or, intracellulary by its S-glutathiolation with no requirement for proteolytical removal of the pro-domain. This protein is thought to be involved in multiple pathways including roles in the nervous system, endometrial menstrual breakdown, regulation of vascularization, and metastasis. Mutations in this gene have been associated with Winchester syndrome and Nodulosis-Arthropathy-Osteolysis (NAO) syndrome. Alternative splicing results in multiple transcript variants encoding different isoforms.

Product Categories/Family for anti-MMP2 antibody

Polyclonal; Neurobiology; Signal Proteins; Signaling Intermediate; Cardiovascular; Signal Transduction; Disease Related

NCBI and Uniprot Product Information

• NCBI GI #: 189217853
• NCBI GeneID: 4313
• NCBI Accession #: NP_001121363.1
• NCBI GenBank Nucleotide #: NM_001127891.2
• UniProt Accession #: P08253
• Molecular Weight: 74 kDa
• NCBI Official Full Name: 72 kDa type IV collagenase isoform 2
• NCBI Official Synonym Full Names: matrix metallopeptidase 2
• NCBI Official Symbol: MMP2
• NCBI Official Synonym Symbols: CLG4; MONA; CLG4A; MMP-2; TBE-1; MMP-II
• NCBI Protein Information: 72 kDa type IV collagenase
• UniProt Protein Name: 72 kDa type IV collagenase
• Protein Family: Matrix metalloproteinase
• UniProt Gene Name: MMP2
• UniProt Synonym Gene Names: CLG4A; MMP-2
• UniProt Entry Name: MMP2_HUMAN

NCBI Description

This gene is a member of the matrix metalloproteinase (MMP) gene family, that are zinc-dependent enzymes capable of cleaving components of the extracellular matrix and molecules involved in signal transduction. The protein encoded by this gene is a gelatinase A, type IV collagenase, that contains three fibronectin type II repeats in its catalytic site that allow binding of denatured type IV and V collagen and elastin. Unlike most MMP family members, activation of this protein can occur on the cell membrane. This enzyme can be activated extracellularly by proteases, or, intracellulary by its S-glutathiolation with no requirement for proteolytical removal of the pro-domain. This protein is thought to be involved in multiple pathways including roles in the nervous system, endometrial menstrual breakdown, regulation of vascularization, and metastasis. Mutations in this gene have been associated with Winchester syndrome and Nodulosis-Arthropathy-Osteolysis (NAO) syndrome. Alternative splicing results in multiple transcript variants encoding different isoforms. [provided by RefSeq, Oct 2014]

Uniprot Description

MMP2: Ubiquitinous metalloproteinase that is involved in diverse functions such as remodeling of the vasculature, angiogenesis, tissue repair, tumor invasion, inflammation, and atherosclerotic plaque rupture. As well as degrading extracellular matrix proteins, can also act on several nonmatrix proteins such as big endothelial 1 and beta-type CGRP promoting vasoconstriction. Also cleaves KISS at a Gly-|-Leu bond. Appears to have a role in myocardial cell death pathways. Contributes to myocardial oxidative stress by regulating the activity of GSK3beta. Cleaves GSK3beta in vitro. Interacts (via the C-terminal hemopexin-like domains- containing region) with the integrin alpha-V/beta-3; the interaction promotes vascular invasion in angiogenic vessels and melamoma cells. Interacts (via the C-terminal PEX domain) with TIMP2 (via the C-terminal); the interaction inhibits the degradation activity. Interacts with GSK3B. Aspirin appears to inhibit expression. Produced by normal skin fibroblasts. PEX is expressed in a number of tumors including gliomas, breast and prostate. Inhibited by histatin-3 1/24 (histatin-5). Belongs to the peptidase M10A family.

Protein type: Cell development/differentiation; Apoptosis; Motility/polarity/chemotaxis; Protease; Secreted, signal peptide; EC 3.4.24.24; Secreted

Chromosomal Location of Human Ortholog: 16q12.2

Cellular Component: proteinaceous extracellular matrix; extracellular space; sarcomere; mitochondrion; extracellular region; plasma membrane; nucleus

Molecular Function: protein binding; zinc ion binding; metalloendopeptidase activity; serine-type endopeptidase activity

Biological Process: axon guidance; extracellular matrix organization and biogenesis; intramembranous ossification; proteolysis; blood vessel maturation; collagen catabolic process; extracellular matrix disassembly; cellular protein metabolic process; positive regulation of innate immune response; response to hypoxia; ephrin receptor signaling pathway; angiogenesis; embryo implantation

Disease: Multicentric Osteolysis, Nodulosis, And Arthropathy