Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (WB Suggested Anti-MMP16 Antibody Titration: 0.2-1 ug/mlELISA Titer: 1:12500Positive Control: MCF7 cell lysate)

Rabbit MMP16 Polyclonal Antibody | anti-MMP16 antibody

MMP16 antibody - N-terminal region

Gene Names
MMP16; MMP-X2; C8orf57; MT-MMP2; MT-MMP3; MT3-MMP
Reactivity
Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat
Applications
Western Blot
Purity
Affinity Purified
Synonyms
MMP16; Polyclonal Antibody; MMP16 antibody - N-terminal region; anti-MMP16 antibody
Ordering
For Research Use Only!
Host
Rabbit
Reactivity
Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat
Clonality
Polyclonal
Purity/Purification
Affinity Purified
Form/Format
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence
Synthetic peptide located within the following region: ALAAMQQFYGINMTGKVDRNTIDWMKKPRCGVPDQTRGSSKFHIRRKRYA
Sequence Length
607
Applicable Applications for anti-MMP16 antibody
Western Blot (WB)
Homology
Cow: 100%; Dog: 100%; Guinea Pig: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Rabbit: 100%; Rat: 100%
Immunogen
The immunogen is a synthetic peptide directed towards the N terminal region of human MMP16
Preparation and Storage
For short term use, store at 2-8 degree C up to 1 week. For long term storage, store at -20 degree C in small aliquots to prevent freeze-thaw cycles.

Western Blot (WB)

(WB Suggested Anti-MMP16 Antibody Titration: 0.2-1 ug/mlELISA Titer: 1:12500Positive Control: MCF7 cell lysate)

Western Blot (WB) (WB Suggested Anti-MMP16 Antibody Titration: 0.2-1 ug/mlELISA Titer: 1:12500Positive Control: MCF7 cell lysate)
Related Product Information for anti-MMP16 antibody
This is a rabbit polyclonal antibody against MMP16. It was validated on Western Blot using a cell lysate as a positive control.

Target Description: Proteins of the matrix metalloproteinase (MMP) family are involved in the breakdown of extracellular matrix in normal physiological processes, such as embryonic development, reproduction, and tissue remodeling, as well as in disease processes, such as arthritis and metastasis. Most MMP's are secreted as inactive proproteins which are activated when cleaved by extracellular proteinases. This gene produces at least two transcripts, one which encodes a membrane-bound form and another soluble form of the protein. Both forms of the protein activate MMP2 by cleavage.Proteins of the matrix metalloproteinase (MMP) family are involved in the breakdown of extracellular matrix in normal physiological processes, such as embryonic development, reproduction, and tissue remodeling, as well as in disease processes, such as arthritis and metastasis. Most MMP's are secreted as inactive proproteins which are activated when cleaved by extracellular proteinases. This gene produces at least two transcripts, one which encodes a membrane-bound form and another a soluble form of the protein. Both forms of the protein activate MMP2 by cleavage. This gene was once referred to as MT-MMP2, but was renamed as MT-MMP3 or MMP16.

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
56kDa
NCBI Official Full Name
matrix metalloproteinase-16
NCBI Official Synonym Full Names
matrix metallopeptidase 16
NCBI Official Symbol
MMP16
NCBI Official Synonym Symbols
MMP-X2; C8orf57; MT-MMP2; MT-MMP3; MT3-MMP
NCBI Protein Information
matrix metalloproteinase-16
UniProt Protein Name
Matrix metalloproteinase-16
Protein Family
UniProt Gene Name
MMP16
UniProt Synonym Gene Names
MMPX2; MMP-16; MT-MMP 3; MTMMP3; MT3-MMP; MT3MMP
UniProt Entry Name
MMP16_HUMAN

NCBI Description

Proteins of the matrix metalloproteinase (MMP) family are involved in the breakdown of extracellular matrix in normal physiological processes, such as embryonic development, reproduction, and tissue remodeling, as well as in disease processes, such as arthritis and metastasis. Most MMP's are secreted as inactive proproteins which are activated when cleaved by extracellular proteinases. The encoded protein activates MMP2 by cleavage. This gene was once referred to as MT-MMP2, but was renamed as MT-MMP3 or MMP16. [provided by RefSeq, Oct 2010]

Uniprot Description

MMP16: Endopeptidase that degrades various components of the extracellular matrix, such as collagen type III and fibronectin. Activates progelatinase A. Involved in the matrix remodeling of blood vessels. Isoform short cleaves fibronectin and also collagen type III, but at lower rate. It has no effect on type I, II, IV and V collagen. However, upon interaction with CSPG4, it may be involved in degradation and invasion of type I collagen by melanoma cells. Belongs to the peptidase M10A family. 2 isoforms of the human protein are produced by alternative splicing.

Protein type: Protease; Membrane protein, integral; EC 3.4.24.-

Chromosomal Location of Human Ortholog: 8q21.3

Cellular Component: proteinaceous extracellular matrix; cell surface; integral to plasma membrane; Golgi lumen; plasma membrane

Molecular Function: zinc ion binding; metalloendopeptidase activity; enzyme activator activity; calcium ion binding

Biological Process: positive regulation of catalytic activity; collagen catabolic process; extracellular matrix disassembly; extracellular matrix organization and biogenesis; embryonic cranial skeleton morphogenesis; proteolysis; endochondral ossification

Research Articles on MMP16

Similar Products

Product Notes

The MMP16 mmp16 (Catalog #AAA3208282) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The MMP16 antibody - N-terminal region reacts with Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat and may cross-react with other species as described in the data sheet. AAA Biotech's MMP16 can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). Researchers should empirically determine the suitability of the MMP16 mmp16 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: Synthetic peptide located within the following region: ALAAMQQFYG INMTGKVDRN TIDWMKKPRC GVPDQTRGSS KFHIRRKRYA. It is sometimes possible for the material contained within the vial of "MMP16, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.