Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (Host: MouseTarget Name: MITFSample Tissue: Mouse PancreasAntibody Dilution: 1ug/ml)

Rabbit MITF Polyclonal Antibody | anti-MITF antibody

MITF antibody - N-terminal region

Gene Names
MITF; MI; WS2; CMM8; WS2A; COMMAD; bHLHe32
Reactivity
Cow, Dog, Goat, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat, Sheep, Zebrafish
Applications
Western Blot
Purity
Protein A purified
Synonyms
MITF; Polyclonal Antibody; MITF antibody - N-terminal region; anti-MITF antibody
Ordering
For Research Use Only!
Host
Rabbit
Reactivity
Cow, Dog, Goat, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat, Sheep, Zebrafish
Clonality
Polyclonal
Purity/Purification
Protein A purified
Form/Format
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence
Synthetic peptide located within the following region: THLENPTKYHIQQAQRQQVKQYLSTTLANKHANQVLSLPCPNQPGDHVMP
Sequence Length
419
Applicable Applications for anti-MITF antibody
Western Blot (WB)
Homology
Cow: 100%; Dog: 100%; Goat: 100%; Guinea Pig: 100%; Horse: 100%; Human: 100%; Mouse: 93%; Rabbit: 100%; Rat: 100%; Sheep: 100%; Zebrafish: 100%
Immunogen
The immunogen is a synthetic peptide directed towards the N terminal region of human MITF
Preparation and Storage
For short term use, store at 2-8 degree C up to 1 week. For long term storage, store at -20 degree C in small aliquots to prevent freeze-thaw cycles.

Western Blot (WB)

(Host: MouseTarget Name: MITFSample Tissue: Mouse PancreasAntibody Dilution: 1ug/ml)

Western Blot (WB) (Host: MouseTarget Name: MITFSample Tissue: Mouse PancreasAntibody Dilution: 1ug/ml)

Western Blot (WB)

(WB Suggested Anti-MITF Antibody Titration: 1.25ug/mlELISA Titer: 1:1562500Positive Control: HepG2 cell lysate)

Western Blot (WB) (WB Suggested Anti-MITF Antibody Titration: 1.25ug/mlELISA Titer: 1:1562500Positive Control: HepG2 cell lysate)
Related Product Information for anti-MITF antibody
This is a rabbit polyclonal antibody against MITF. It was validated on Western Blot using a cell lysate as a positive control.

Target Description: MITF is a transcription factor that contains both basic helix-loop-helix and leucine zipper structural features. It regulates the differentiation and development of melanocytes retinal pigment epithelium and is also responsible for pigment cell-specific transcription of the melanogenesis enzyme genes. Heterozygous mutations in the this gene cause auditory-pigmentary syndromes, such as Waardenburg syndrome type 2 and Tietz syndrome. Alternatively spliced transcript variants encoding different isoforms have been identified.

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
47kDa
NCBI Official Full Name
microphthalmia-associated transcription factor isoform 4
NCBI Official Synonym Full Names
melanocyte inducing transcription factor
NCBI Official Symbol
MITF
NCBI Official Synonym Symbols
MI; WS2; CMM8; WS2A; COMMAD; bHLHe32
NCBI Protein Information
microphthalmia-associated transcription factor
UniProt Protein Name
Microphthalmia-associated transcription factor
UniProt Gene Name
MITF
UniProt Synonym Gene Names
BHLHE32; bHLHe32
UniProt Entry Name
MITF_HUMAN

NCBI Description

The protein encoded by this gene is a transcription factor that contains both basic helix-loop-helix and leucine zipper structural features. The encoded protein regulates melanocyte development and is responsible for pigment cell-specific transcription of the melanogenesis enzyme genes. Heterozygous mutations in the this gene cause auditory-pigmentary syndromes, such as Waardenburg syndrome type 2 and Tietz syndrome. [provided by RefSeq, Aug 2017]

Uniprot Description

MITF: a transcription factor that contains both basic helix-loop-helix and leucine zipper structural features. Plays a critical role in the differentiation of various cell types including neural crest- derived melanocytes, mast cells, osteoclasts and optic cup-derived retinal pigment epithelium. Two isoforms are known: the M-isoform is expressed exclusively in melanocytes, while the A-isoform has a much broader range of expression. Mutations in MITF can lead to Waardenburg syndrome. Ten alternatively spliced isoforms have been described.

Protein type: DNA-binding; Transcription factor; Oncoprotein

Chromosomal Location of Human Ortholog: 3p14.2-p14.1

Cellular Component: protein complex; nucleus

Molecular Function: protein dimerization activity; RNA polymerase II transcription factor activity, enhancer binding; protein binding; chromatin binding

Biological Process: transcription from RNA polymerase II promoter; cell fate commitment; camera-type eye development; regulation of osteoclast differentiation; regulation of transcription, DNA-dependent; positive regulation of transcription, DNA-dependent; melanocyte differentiation; protein complex assembly; positive regulation of transcription from RNA polymerase II promoter; osteoclast differentiation; negative regulation of transcription from RNA polymerase II promoter; bone remodeling; regulation of cell proliferation

Disease: Albinism, Ocular, With Sensorineural Deafness; Waardenburg Syndrome, Type 2a; Melanoma, Cutaneous Malignant, Susceptibility To, 8; Tietz Syndrome

Research Articles on MITF

Similar Products

Product Notes

The MITF mitf (Catalog #AAA3203834) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The MITF antibody - N-terminal region reacts with Cow, Dog, Goat, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat, Sheep, Zebrafish and may cross-react with other species as described in the data sheet. AAA Biotech's MITF can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). Researchers should empirically determine the suitability of the MITF mitf for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: Synthetic peptide located within the following region: THLENPTKYH IQQAQRQQVK QYLSTTLANK HANQVLSLPC PNQPGDHVMP. It is sometimes possible for the material contained within the vial of "MITF, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.