Western Blot (WB)
(Host: RabbitTarget Name: MICALCLSample Tissue: Rat Lung lysatesAntibody Dilution: 1ug/ml)
Rabbit anti-Rat MICALCL Polyclonal Antibody | anti-MICALCL antibody
MICALCL Antibody - C-terminal region
Gene Names
Micalcl; RSB-11-77
Reactivity
Rat
Applications
Western Blot
Purity
Affinity purified
Synonyms
MICALCL; Polyclonal Antibody; MICALCL Antibody - C-terminal region; anti-MICALCL antibody
Host
Rabbit
Reactivity
Rat
Clonality
Polyclonal
Purity/Purification
Affinity purified
Form/Format
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence
Synthetic peptide located within the following region: AQLLQEWFKLVLEKNKLMRYESELLIMAQELELEDHQSRLEQKLRQKMLK
Sequence Length
528
Applicable Applications for anti-MICALCL antibody
Western Blot (WB)
Immunogen
The immunogen is a synthetic peptide directed towards the C terminal region of rat MICALCL
Preparation and Storage
For short term use, store at 2-8 degree C up to 1 week. For long term storage, store at -20 degree C in small aliquots to prevent freeze-thaw cycles.
Western Blot (WB)
(Host: RabbitTarget Name: MICALCLSample Tissue: Rat Lung lysatesAntibody Dilution: 1ug/ml)
Western Blot (WB)
(Host: RabbitTarget Name: MICALCLSample Tissue: Rat Lung lysatesAntibody Dilution: 1ug/ml)
Related Product Information for anti-MICALCL antibody
May cooperate with MAPK1/ERK2 via an intracellular signal transduction pathway in the morphogenetic development of round spermatids to spermatozoa. May act as Rab effector protein and play a role in vesicle trafficking.
Product Categories/Family for anti-MICALCL antibody
NCBI and Uniprot Product Information
NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
58 kDa
NCBI Official Full Name
MICAL C-terminal-like protein
NCBI Official Synonym Full Names
MICAL C-terminal like
NCBI Official Symbol
Micalcl
NCBI Official Synonym Symbols
RSB-11-77
NCBI Protein Information
MICAL C-terminal-like protein
UniProt Protein Name
MICAL C-terminal-like protein
Protein Family
UniProt Gene Name
Micalcl
UniProt Entry Name
MICLK_RAT
Uniprot Description
Function: May cooperate with MAPK1/ERK2 via an intracellular signal transduction pathway in the morphogenetic development of round spermatids to spermatozoa
By similarity.
Subunit structure: Interacts with MAPK1/ERK2
By similarity.
Subcellular location: Cytoplasm
By similarity.
Sequence similarities: Belongs to the ebitein family.
Sequence caution: The sequence AAI00138.1 differs from that shown. Reason: Erroneous initiation. The sequence AAN46735.1 differs from that shown. Reason: Frameshift at position 364.
Similar Products
Product Notes
The MICALCL micalcl (Catalog #AAA3223937) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The MICALCL Antibody - C-terminal region reacts with Rat and may cross-react with other species as described in the data sheet. AAA Biotech's MICALCL can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). Researchers should empirically determine the suitability of the MICALCL micalcl for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: Synthetic peptide located within the following region: AQLLQEWFKL VLEKNKLMRY ESELLIMAQE LELEDHQSRL EQKLRQKMLK. It is sometimes possible for the material contained within the vial of "MICALCL, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.Precautions
All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.Disclaimer
Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.Item has been added to Shopping Cart
If you are ready to order, navigate to Shopping Cart and get ready to checkout.
